 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F030288 |
| Family Type | Metagenome |
| Number of Sequences | 186 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLATLL |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 184 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 54.89 % |
| % of genes near scaffold ends (potentially truncated) | 35.48 % |
| % of genes from short scaffolds (< 2000 bps) | 59.14 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.355 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (46.237 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.806 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.183 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.08% β-sheet: 0.00% Coil/Unstructured: 56.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 184 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 10.33 |
| PF12353 | eIF3g | 2.17 |
| PF04690 | YABBY | 1.09 |
| PF01402 | RHH_1 | 1.09 |
| COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 10.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.35 % |
| All Organisms | root | All Organisms | 30.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 46.24% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.29% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.99% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 5.38% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.76% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.76% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.69% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.15% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.61% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.08% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.08% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.08% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.08% |
| Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 1.08% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.08% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 1.08% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 1.08% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.54% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.54% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.54% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.54% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.54% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.54% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 0.54% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.54% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.54% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.54% |
| Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300003142 | Marine sediment microbial communities from deep subseafloor - Sample from 5.1 mbsf | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
| 3300005078 | Microbial Community from Halfdan Field MHBA5 | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005882 | Hydrocarbon microbial community from Halfdan Field MHF | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006622 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ08 time point | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007655 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007896 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3 | Environmental | Open in IMG/M |
| 3300007906 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_1 | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300011261 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300022064 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 (v2) | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
| 3300029293 | Marine harbor viral communities from the Indian Ocean - SCH2 | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029753 | Marine harbor viral communities from the Indian Ocean - SRH3 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100268773 | 3300000101 | Marine | MRLTEPVAPIDKEQNERIVWCERLLYLIVLLQFPQIATLI* |
| JGI24006J15134_100175853 | 3300001450 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVVLQFPQIATLL* |
| JGI24006J15134_100183603 | 3300001450 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVVLQFPQIASLL* |
| JGI24004J15324_100193006 | 3300001472 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLV* |
| Ga0052242_10004806 | 3300003142 | Marine Sediment | MSTGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQIASLL* |
| Ga0052242_10023422 | 3300003142 | Marine Sediment | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLADIII* |
| Ga0068513_10009805 | 3300004951 | Marine Water | MQSEAIAPIDLEQNNKIAWCEKLLYALVLLQFPQIATIL* |
| Ga0070431_10392632 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | MSAAGLDAIAPVDIAQNERIVWCERLLYALIVLQFPQLVTLFPLG* |
| Ga0070770_100815541 | 3300005078 | Water | KVDEEMTIPLAPVDQEQNERIVWCERLLYLIVVLQFPQLASIVM* |
| Ga0072334_103184323 | 3300005086 | Water | VVQLIDPVAPIDKEQNERIVWCERLLYLIVVLQFPQIASILV* |
| Ga0070727_100361345 | 3300005590 | Marine Sediment | MERLAEIDLSQNNRIAWCERLLMLIVVLQFPQLATLVM* |
| Ga0078893_104906263 | 3300005837 | Marine Surface Water | VVYMEAIAPIDVEQNNKIAWCEKLLYALVLLQFPQIATLL* |
| Ga0080455_10471734 | 3300005882 | Water | MTIPLAPVDQEQNERIVWCERLLYLIVVLQFPQLASIVM* |
| Ga0075462_101843872 | 3300006027 | Aqueous | MDLAPIDKEQNAKIAWCEKLLYALVLLQFPQLASIVM |
| Ga0101442_1232793 | 3300006622 | Marine Surface Water | MEAIAPIDVEQNNKIAWCEKLLYALVLLQFPQIATLL* |
| Ga0098037_10237393 | 3300006737 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLI* |
| Ga0098037_10837312 | 3300006737 | Marine | MKKVDAEQNERIAWCEKLLYALVILQFPQIATLL* |
| Ga0098042_100568711 | 3300006749 | Marine | MSQGLEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLASLV* |
| Ga0098042_10056875 | 3300006749 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVVLQFPQLASLAM* |
| Ga0070750_101621842 | 3300006916 | Aqueous | MQGTLEAIAPIDKQQNERIVWCERLLYLIVILQFPQLASLI* |
| Ga0070750_104812371 | 3300006916 | Aqueous | MKAIAPIDEEQNERIVWCERLLYLIVMLQFPQLASLAF* |
| Ga0070748_10407423 | 3300006920 | Aqueous | MLEPVAPIDREQNERIVWCERLLYALVILQFPQLVAIL* |
| Ga0070748_11926451 | 3300006920 | Aqueous | EKD*KIMQGTLEAIAPIDKQQNERIVWCERLLYLIVILQFPQLASLI* |
| Ga0098060_10102593 | 3300006921 | Marine | MKAVDKEQNLKIAWCEKLLYAMIILQFPQLANLI* |
| Ga0098036_10254964 | 3300006929 | Marine | MDAIAPIDIEQNNKIAWCEKLLYALVILQFPQIATLL* |
| Ga0075469_100184245 | 3300007231 | Aqueous | MEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLATLI* |
| Ga0075463_100093552 | 3300007236 | Aqueous | MQEPIAPIDKEQNERIVWCERLLYLIVLLQFPQIASLL* |
| Ga0070747_10241794 | 3300007276 | Aqueous | MEAIAPIDKEQNERIVWCERLLYLIVLLQFPQIASLL* |
| Ga0099847_10080354 | 3300007540 | Aqueous | MEDIDVQQNRRIEWCEKLLYAIVILQFPQIAALL* |
| Ga0099847_11973912 | 3300007540 | Aqueous | DAVSGVDMQEPIAPIDKEQNERIVWCERLLYLIVLLQFPQIASLL* |
| Ga0102825_10577761 | 3300007655 | Estuarine | MRLTEPVAPIDREQNERIVWCERLLYLIVLLQFPQLATLL* |
| Ga0105744_11844082 | 3300007863 | Estuary Water | KEMERLAEIDLSQNNRIAWCERLLMLIVALQFPQLAALVM* |
| Ga0111484_10172954 | 3300007896 | Sediment | MEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLI* |
| Ga0111482_10029002 | 3300007906 | Sediment | MVVDPVAPIDREQNERIVWCERLLYLIVLLQFPQLATLL* |
| Ga0111482_10832532 | 3300007906 | Sediment | KVDEEMSIPLAPVDQEQNERIVWCERLLYLIVLLQFPQLASLAM* |
| Ga0115863_11285794 | 3300009034 | Sediment, Intertidal | MIEAIAPIDQEQNNKIAWCEKLLYALVLLQFPQIATLL* |
| Ga0102854_10237031 | 3300009058 | Estuarine | MMNAPIDEEQNNRIAMCEKLLMLLVLLQFPQLASM |
| Ga0114925_104015843 | 3300009488 | Deep Subsurface | MTEAIAPIDLEQNNKIAWCEKLLYALVLLQFPQIATLL* |
| Ga0114920_101987822 | 3300009528 | Deep Subsurface | MKAIDKLQNEKIAWCEKLLYALVVLQFPQIATLL* |
| Ga0114920_104877643 | 3300009528 | Deep Subsurface | IAPIDIAQNNKIAWCEKLLYALVLLQFPQIATLL* |
| Ga0114920_105223592 | 3300009528 | Deep Subsurface | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQIASLL* |
| Ga0114920_109247162 | 3300009528 | Deep Subsurface | MTSPIAPIDIEQNNKIAWCEKLLYALVLLQFPQIATLL* |
| Ga0114920_109588251 | 3300009528 | Deep Subsurface | MEAIAPIDKQQNERIVWCERLLYLIILLQFPQLANLLV |
| Ga0114920_109756932 | 3300009528 | Deep Subsurface | TMKAIDKLQNETIAWCEKLLYALVLLQFPQIATLI* |
| Ga0114919_104716901 | 3300009529 | Deep Subsurface | MTIPLAPVDQEQNERIVWCERLLYLIVLLQFPQLASLA |
| Ga0115011_101490922 | 3300009593 | Marine | MGVEPVTSEPVAPIDREQNERIVWCERLLYLLVVLQFPQIATLL* |
| Ga0115011_102418611 | 3300009593 | Marine | DGKEVEAIAPIDQAQNERIVWCERLLYLIVLLQFPQLASLLT* |
| Ga0118733_1003223335 | 3300010430 | Marine Sediment | MTKIDDLQDRKIAACEKLLALIVLLQFPQIAALI* |
| Ga0114922_104438783 | 3300011118 | Deep Subsurface | MSNPIAPIDIEQNNKIAWCEKLLYALVLLQFPQIATLL* |
| Ga0151671_10110204 | 3300011253 | Marine | MIDPIAPIDVEQNNKIAWCEKLLYTLVILQFPQIATLL* |
| Ga0151671_10268502 | 3300011253 | Marine | MKKVDQQQNERIEWCEKLLYAIVILQFPQVAALL* |
| Ga0151677_10166393 | 3300011258 | Marine | MIDPIAPIDVEQNNKIAWCEKLLYALVILQFPQIATLL* |
| Ga0151677_10380945 | 3300011258 | Marine | MEAIAPIDKEQNERIVWCERLLYLIVVLQFPQLASLAM* |
| Ga0151677_11838463 | 3300011258 | Marine | PMNAPIDEEQNNRIAMCEKLLMLIVLLQFPQLASMI* |
| Ga0151661_10803891 | 3300011261 | Marine | MEIPLAPVDQEQNERIVWCERLLYLIVLLQFPQLAT |
| Ga0151661_12396072 | 3300011261 | Marine | MKAIDKEQNLKIAWCEKLLYAIVILQFPQLANLI* |
| Ga0160422_100504492 | 3300012919 | Seawater | MQGIPEAIAPIDQQQNERIVWCERLLYLVVLLQFPQLATIVM* |
| Ga0160423_100644943 | 3300012920 | Surface Seawater | MVDPLAPIDKEQNERIVWCERLLYLVVLLQFPQLADIVL* |
| Ga0160423_101589791 | 3300012920 | Surface Seawater | MQGTPEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLI* |
| Ga0160423_107850073 | 3300012920 | Surface Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLADIIL* |
| Ga0163179_100370704 | 3300012953 | Seawater | MLEEIDIEQNNKIAWCEKLLYALVVLQFPQIIEIL* |
| Ga0164321_103751532 | 3300014903 | Marine Sediment | MKAIDKIQNEKIAWCEKLLYALVLLQFPQIATLL* |
| Ga0164311_104627521 | 3300014914 | Marine Sediment | IAPIDLEQNNKIAWCEKLLYALVLLQFPQIATLL* |
| Ga0180120_101808372 | 3300017697 | Freshwater To Marine Saline Gradient | MLEPVAPIDREQNERIVWCERLLYALVILQFPQLVAIL |
| Ga0181387_10056404 | 3300017709 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLATLV |
| Ga0181403_10045933 | 3300017710 | Seawater | MIEAIAPIDLEQNNKIAWCEKLLYALVLLQFPQIASLL |
| Ga0181403_10347161 | 3300017710 | Seawater | GASKEAGKEMEAIAPIDKQQNERIVWCERLLYLIVLLQFPQIASLL |
| Ga0181403_10875131 | 3300017710 | Seawater | ITQGIEAIAPIDQKQNERIVWCERLLYLIVILQFPQIATLI |
| Ga0181412_10175884 | 3300017714 | Seawater | MSTGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLATLI |
| Ga0181412_10188841 | 3300017714 | Seawater | MSTGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQIAS |
| Ga0181412_10415402 | 3300017714 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLVV |
| Ga0181412_10460931 | 3300017714 | Seawater | MSTGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLAM |
| Ga0181404_10064471 | 3300017717 | Seawater | MRLTQPEPIAPIDRAQNERIVWCERLLILIVLLQFPQIATLL |
| Ga0181404_10173654 | 3300017717 | Seawater | VEKMKAIDKIQNEKIAWCEKLLYALVILQFPQIATLL |
| Ga0181404_10200733 | 3300017717 | Seawater | MMEAIAPIDKQQNERIVWCERLLYLIVVLQFPQLASLAM |
| Ga0181383_10057016 | 3300017720 | Seawater | MTTPLAPVDQEQNERIVWCERLLYLIVLLQFPQLATLI |
| Ga0181383_10064912 | 3300017720 | Seawater | MEAIAPIDKEQNERIVWCERLLYLIVVLQFPQLASLI |
| Ga0181383_10108696 | 3300017720 | Seawater | MSQGLEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLASLV |
| Ga0181388_10263752 | 3300017724 | Seawater | MALEPVAPIDKEQNERIVWCERLLYLIVLLQFPQIASLL |
| Ga0181381_10107043 | 3300017726 | Seawater | MALDPVAPIDKEQNERIVWCERLLYLIVILQFPQIATLL |
| Ga0181401_10082266 | 3300017727 | Seawater | MIEAIAPIDQEQNNKIAWCEKLLYALVLLQFPQIASLL |
| Ga0181401_10086383 | 3300017727 | Seawater | MHGSDVLKAIDKAQNERIVWCERLLYAIIVLQFPQLAELII |
| Ga0181416_10276371 | 3300017731 | Seawater | MHQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLV |
| Ga0181415_10048533 | 3300017732 | Seawater | MIAPIDQEQNNKIAWCEKLLYALVLLQFPQIATLL |
| Ga0181415_10090341 | 3300017732 | Seawater | IAPIDKQQNERIVWCERLLYLIVLLQFPQLASLVV |
| Ga0181415_10631701 | 3300017732 | Seawater | QGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLAM |
| Ga0181426_10054353 | 3300017733 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASIAM |
| Ga0181426_10054624 | 3300017733 | Seawater | MSQGLEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLASLAM |
| Ga0181426_10089472 | 3300017733 | Seawater | MPQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0181428_10045406 | 3300017738 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQIASLL |
| Ga0181433_10169492 | 3300017739 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIILLQFPQIANLIV |
| Ga0181418_10202213 | 3300017740 | Seawater | MSQGLEAIAPIDKQQNERILWCERLLYLIVLLQFPQLASLAM |
| Ga0181418_11401291 | 3300017740 | Seawater | TIEKDGKKVEAIAPIDKEQNERIVWCERLLYLIVVLQFPQLASLAM |
| Ga0181418_11734481 | 3300017740 | Seawater | GSEKITQGIEAIAPIDQKQNERIVWCERLLYLIVLLQFPQIATLL |
| Ga0181421_10116011 | 3300017741 | Seawater | DSQRTEGDKEMSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLAM |
| Ga0181399_10810473 | 3300017742 | Seawater | QGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLVV |
| Ga0181402_10257761 | 3300017743 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQ |
| Ga0181402_11071093 | 3300017743 | Seawater | GDKEMSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLAM |
| Ga0181402_11867802 | 3300017743 | Seawater | MSTGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQ |
| Ga0181397_10176423 | 3300017744 | Seawater | MPQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLVV |
| Ga0181389_11560932 | 3300017746 | Seawater | MSTGLEAIAPIDKQQNERIVWCERLLYLIVVLQFPQLASLAM |
| Ga0181393_10740541 | 3300017748 | Seawater | MSQGLEAIALIDKQQNERIVWCERLLYLIVLLQFPQLASLAM |
| Ga0181405_10758263 | 3300017750 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLA |
| Ga0181405_11342831 | 3300017750 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLAL |
| Ga0187219_10139425 | 3300017751 | Seawater | MEAIAPIDQKQNERIVWCERLLYLIVLLQFPQLASIL |
| Ga0181400_10268231 | 3300017752 | Seawater | DSKTTRKVDEEMTIPLAPVDQEQNERIVWCERLLYLIILLQFPQLANLLV |
| Ga0181400_11281442 | 3300017752 | Seawater | VEKMKAIDKIQNEKIAWCEKLLYALVILQFPQIATLI |
| Ga0181407_10156131 | 3300017753 | Seawater | ITQGIEAIAPIDQKQNERIVWCERLLYLIVLLQFPQIATLL |
| Ga0181411_10091596 | 3300017755 | Seawater | RTTGSEEITQGIEAIAPIDQKQNERIVWCERLLYLIVLLQFPQIATLL |
| Ga0181420_10072707 | 3300017757 | Seawater | MALDPVAPIDREQNERIVWCERLLYALVILQFPQLAALL |
| Ga0181420_10164377 | 3300017757 | Seawater | SQGTEGDKEMSQGLEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLASLV |
| Ga0181420_10188771 | 3300017757 | Seawater | RIVGAKEMSPDLEAIAPIYKQQNERIVWCERLLYLIVLLQFPQLASLAM |
| Ga0181420_10822513 | 3300017757 | Seawater | TEPIAPIDRAQNERIVWCERLLILIVLLQFPQIATLL |
| Ga0181420_10846951 | 3300017757 | Seawater | MPQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFP |
| Ga0181420_11058181 | 3300017757 | Seawater | EGDKEMPQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0181420_11296471 | 3300017757 | Seawater | MEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLASLA |
| Ga0181420_11456874 | 3300017757 | Seawater | EEITQGIEAIAPIDQKQNERIVWCERLLYLIVLLQFPQIATLL |
| Ga0181409_10247775 | 3300017758 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYAIILLQFPQIASLM |
| Ga0181409_11336901 | 3300017758 | Seawater | RTTGSEEITQGIEAIAPIDVEQNNKIAWCEKLLYALVILQFPQIATLI |
| Ga0181409_12503891 | 3300017758 | Seawater | PQTSQEAGKEMEAIAPIDKQQNERIVWCERLLYLIVLLQFPQIASLL |
| Ga0181414_11241031 | 3300017759 | Seawater | MHQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFP |
| Ga0181422_10091876 | 3300017762 | Seawater | VILDPVDEEQNERIVWCERLLYFLVMLQFPQLASIVM |
| Ga0181422_10105851 | 3300017762 | Seawater | MIPLAPVDQEQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0181422_10105858 | 3300017762 | Seawater | VDEEMIPLAPVDQEQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0181410_10932372 | 3300017763 | Seawater | DKEMSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0181410_11178211 | 3300017763 | Seawater | KEMSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLAM |
| Ga0181385_10088975 | 3300017764 | Seawater | MRLMALDPVAPIDKEQNERIVWCERLLYLIVILQFPQIATLL |
| Ga0181385_10100614 | 3300017764 | Seawater | MEAIAPIDVEQNNKIAWCEKLLYVLVILQFPQVATLL |
| Ga0181385_11135601 | 3300017764 | Seawater | MSQGFEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLADIIM |
| Ga0181413_10183691 | 3300017765 | Seawater | LAPIDEQQNERIVWCERLLYLIVLLQFPQLASLVV |
| Ga0181413_12036101 | 3300017765 | Seawater | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLA |
| Ga0181413_12159942 | 3300017765 | Seawater | IKGVEKITQGLEAIAPIDKQQNERIVWCERLLYLIVILQFPQIATLL |
| Ga0181430_10092754 | 3300017772 | Seawater | MSIPLAPVDQEQNERIVWCERLLYLIVLLQFPQLVTLI |
| Ga0181430_11471161 | 3300017772 | Seawater | MALDPVAPIDREQNERIVWCERLLYALVILQFPQLAAL |
| Ga0181394_11989283 | 3300017776 | Seawater | GSEEITQGIEAIAPIDQKQNERIVWCERLLYLIVLLQFPQIATLL |
| Ga0181395_10895661 | 3300017779 | Seawater | DGKELEAIAPIDKEQNERIVWCERLLYLIVLMQFPQLASLI |
| Ga0181423_10162571 | 3300017781 | Seawater | DEEMIPLAPVDQEQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0181423_12757701 | 3300017781 | Seawater | QWQHSDVLIDMSIPLAPVDQEQNERIVWCERLLYLIVLLQFPQLVTLI |
| Ga0181380_10215864 | 3300017782 | Seawater | MPQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLAM |
| Ga0181380_10923891 | 3300017782 | Seawater | KRTTGSEEITQGIEAIAPIDQKQNERIVWCERLLYLIVLLQFPQIATLL |
| Ga0181380_11977972 | 3300017782 | Seawater | VIKMEDIDVQQNRRIEWCEKLLYAIVVLQFPQIAALL |
| Ga0181380_12794121 | 3300017782 | Seawater | CSEMRLMALDPVAPIDKEQNERIVWCERLLYLIVILQFPQIATLL |
| Ga0181379_10118866 | 3300017783 | Seawater | MLDPVDEEQNHRIAWCEKLLYAIILLQFPQLAQMM |
| Ga0181424_102686242 | 3300017786 | Seawater | GDKEMPQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0181424_103380241 | 3300017786 | Seawater | RTTGSEEITQGIEAIAPIDQKQNERIVWCERLLYLIVLLQFPQIVTLL |
| Ga0181424_104037221 | 3300017786 | Seawater | MMEAIAPIDKDQNNRIAWCEKLLYALVILQFPQIASLL |
| Ga0211617_100284602 | 3300020401 | Marine | MTDPIAPIDKEQNERIVWCERLLYLIVLLQFPQLATLI |
| Ga0211617_100427405 | 3300020401 | Marine | MEAIAPIDQKQNERIVWCERLLYLIVLLQFPQLATLI |
| Ga0211574_101053692 | 3300020446 | Marine | MSDAVAPVDIAQNERIVWCERLLYALIALQFPQLANVLM |
| Ga0206677_103834493 | 3300021085 | Seawater | MNAPIDEEQNNRIAMCEKLLMLIVLLQFPQLASMI |
| Ga0224899_1000185 | 3300022064 | Seawater | MEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLATLL |
| (restricted) Ga0233412_101419381 | 3300023210 | Seawater | RIAEIDLSQNNRIAWCERLLMLIVALQFPQLAALVM |
| (restricted) Ga0233410_100294332 | 3300023276 | Seawater | MERLAEIDLSQNNRIAWCERLLMLIVALQFPQLAALVM |
| (restricted) Ga0255039_101459592 | 3300024062 | Seawater | MTNPIAPIDIEQNNKIAWCEKLLYALVILQFPQIATLI |
| Ga0209986_100907411 | 3300024433 | Deep Subsurface | MSNPIAPIDIEQNNKIAWCEKLLYALVLLQFPQIATLL |
| (restricted) Ga0255046_101405314 | 3300024519 | Seawater | SEEITQGIEAIAPIDVEQNNKIAWCDKLLYALVILQFPQIATLL |
| (restricted) Ga0255046_103390161 | 3300024519 | Seawater | RLAEIDLSQNNRIAWCERLLMLIVALQFPQLAALVM |
| (restricted) Ga0255047_100436696 | 3300024520 | Seawater | MLDPIDKEQNDRIVWCERLLYVLCAAQFPQLMALM |
| Ga0208157_10151833 | 3300025086 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0208159_10860892 | 3300025101 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVVLQFPQLASLAM |
| Ga0208793_10402764 | 3300025108 | Marine | MEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0208919_10136137 | 3300025128 | Marine | MDAIAPIDIEQNNKIAWCEKLLYALVILQFPQIATLL |
| Ga0209634_12340202 | 3300025138 | Marine | VMVQLVEPIDEQQNQRIVWCERLLYLVVVLQFPQLASILV |
| Ga0209634_12406881 | 3300025138 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVVLQFPQIATLL |
| Ga0209337_10282912 | 3300025168 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLATLI |
| Ga0209337_10424152 | 3300025168 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLASLV |
| Ga0208303_10081273 | 3300025543 | Aqueous | MRLTEPVAPIDREQNERIVWCERLLYLIVLLQFPQLATLL |
| Ga0208660_11072811 | 3300025570 | Aqueous | MEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLATLI |
| Ga0208899_11405812 | 3300025759 | Aqueous | MQGTLEAIAPIDKQQNERIVWCERLLYLIVILQFPQLASLI |
| Ga0209273_100242613 | 3300027790 | Marine Sediment | MERLAEIDLSQNNRIAWCERLLMLIVVLQFPQLATLVM |
| Ga0209578_100317908 | 3300027820 | Marine Sediment | MKLENLAPIDQEQNAKIAWCEKLLYALVILQFPQLAQLL |
| (restricted) Ga0255054_106353312 | 3300027856 | Seawater | MERLAEIDLSQNNRIAWCERLLMLIVALQFPQLAA |
| (restricted) Ga0255055_100186914 | 3300027881 | Seawater | MVMKKIDHEQNDRIAMCEKLLYAIVLLQFPQLAILL |
| (restricted) Ga0255055_100242485 | 3300027881 | Seawater | MLDPVAPIDKEQNERIVWCERLLILIVVLQFPQLASILV |
| (restricted) Ga0255055_104276113 | 3300027881 | Seawater | TTGSEEITQGIEAIAPIDQKQNERIVWCERLLYLIVLLQFPQIATLL |
| Ga0209404_102821561 | 3300027906 | Marine | VTSEPVAPIDREQNERIVWCERLLYLLVVLQFPQIATLL |
| Ga0209404_106806652 | 3300027906 | Marine | MSQGLEAIAPIDKQQNERIVWCERLLYLIVLLQFPQLADIII |
| Ga0256383_1018155 | 3300028448 | Seawater | ITEAIAPIDQKQNERIVWCERLLYFIVVLQFPQIVTLL |
| Ga0135211_10188422 | 3300029293 | Marine Harbor | MSQGLEAIAPIDKEQNERIVWCERLLYLIVLLQFPQLASLI |
| Ga0183683_10065292 | 3300029309 | Marine | MTTPIAEIDQQQNERIVWCERLLYLIVLLQFPQLASLV |
| Ga0183683_10185545 | 3300029309 | Marine | MQGTSQAIAPIDKEQNERIVWCERLLYLVVILQFPQLATLI |
| Ga0183683_10401352 | 3300029309 | Marine | MQGIPEAIAPIDKQQNERIVWCERLLYLVVLLQFPQLATIVM |
| Ga0185543_10147283 | 3300029318 | Marine | MSVTEPIAPIDKQQNERIVWCERLLYAIILLQFPQIASLM |
| Ga0135224_10298592 | 3300029753 | Marine Harbor | MQGISEVIAPIDQQQNAKIAWCKKLLYALVILQFPQIASLI |
| Ga0316203_10108082 | 3300032274 | Microbial Mat | MVNAPIDDEQNNRIAMCEKLLYALVILQFPQVASLMM |
| Ga0316202_100209485 | 3300032277 | Microbial Mat | MRLTEPVAAIDREQNERIVWCERLLYLIVLLQFPQLATLL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |