Scaffold Ga0049085_10177619

Overview

Basic Information

• Taxon OID: 3300005583
• Scaffold ID: Ga0049085_10177619
• Source Dataset Name: Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 712
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Harrisonbacteria → Candidatus Harrisonbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_44_23 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location

• Location Name: Great Lakes, Michigan, USA
• Coordinates
  • Lat. (^o): 44.5046
  • Long. (^o): -83.045851

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103227	Metagenome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0049085_101776192	F103227	AGGAG	MKDSFAFIYLHRTNGAIRVESLETARRVDNRPEWKHVSTVNAHVCLENILTASTRQRTQYIRDLLK*