Scaffold Ga0074230_1912979

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074230_1912979

Scaffold Ga0074230_1912979

Overview

Basic Information
Taxon OID	3300005504 Open in IMG/M
Scaffold ID	Ga0074230_1912979 Open in IMG/M
Source Dataset Name	Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay community
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	509
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor → Poplar Biomass Bioreactor Microbial Communities From Brookhaven National Lab, Ny

Source Dataset Sampling Location
Location Name	Upton, NY
Coordinates	Lat. (^o)	40.869444	Long. (^o)	-72.886667	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085858	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074230_19129791	F085858	N/A	QLAKPFPKNEKAEDPLIMRTDDMKEFSEVIRSKIIPTTFVFQCTLCGLEISDYDRHFGLIKMNQHVMSEHANQVKSLDMEDLYSRKPTVVLESF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.