| Basic Information | |
|---|---|
| Taxon OID | 3300005487 Open in IMG/M |
| Scaffold ID | Ga0074211_112403 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 840 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Methylotrophic Communities From Lake Washington, Seattle, Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Washington, Seattle | |||||||
| Coordinates | Lat. (o) | 47.63458 | Long. (o) | -122.26655 | Alt. (m) | Depth (m) | 63 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006851 | Metagenome | 363 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074211_1124031 | F006851 | N/A | MARPARIDLRSFQDELATRLAAKTAAQVESSRLGLACGGMHWLIRLGTPPR* |
| ⦗Top⦘ |