| Basic Information | |
|---|---|
| Taxon OID | 3300005479 Open in IMG/M |
| Scaffold ID | Ga0074232_109726 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from EBPR reactors in the US and Australia - sample from Queensland, Australia |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 985 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Microbial Communities From Ebpr Reactors In The Us And Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Austrailia: Brisbane, Queensland | |||||||
| Coordinates | Lat. (o) | -27.4872 | Long. (o) | 153.1974 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104545 | Metagenome / Metatranscriptome | 100 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074232_1097261 | F104545 | N/A | GVSTEVLPRMTAKGVRVGKDQPIRTCTAQHARQRIVGQQAGIDCDAATKAVRVPTGSGQPDVEPVDTILRPVGRRKTFRDVPASIGRVRQRLEMARVPKPFQHTVIKVAVQKSDR* |
| ⦗Top⦘ |