3300005479: Activated sludge microbial communities from EBPR reactors in the US and Australia - sample from Queensland, Australia

Overview

Basic Information

• IMG/M Taxon OID: 3300005479
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0045009 | Gp0051192 | Ga0074232
• Sample Name: Activated sludge microbial communities from EBPR reactors in the US and Australia - sample from Queensland, Australia
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 26490200
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Activated Sludge Microbial Communities From Ebpr Reactors In The Us And Australia
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Microbial Communities From Ebpr Reactors In The Us And Australia

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Austrailia: Brisbane, Queensland
• Coordinates
  • Lat. (^o): -27.4872
  • Long. (^o): 153.1974
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104545	Metagenome / Metatranscriptome	100	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0074232_109726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	985

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074232_109726	Ga0074232_1097261	F104545	GVSTEVLPRMTAKGVRVGKDQPIRTCTAQHARQRIVGQQAGIDCDAATKAVRVPTGSGQPDVEPVDTILRPVGRRKTFRDVPASIGRVRQRLEMARVPKPFQHTVIKVAVQKSDR*