Scaffold Ga0074646_101079

Overview

Basic Information

• Taxon OID: 3300005470
• Scaffold ID: Ga0074646_101079
• Source Dataset Name: Saline benthic water microbial community from Etoliko Lagoon, Greece
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 7240
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location

• Location Name: Etoliko Lagoon, Greece
• Coordinates
  • Lat. (^o): 38.468307
  • Long. (^o): 21.333032
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061366	Metagenome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074646_1010798	F061366	N/A	MSWGVTIRNSVAIGLGGIISLFSGYGRDNDLINLATESGDNLVQEDGGFIII*