Basic Information | |
---|---|
Taxon OID | 3300005469 Open in IMG/M |
Scaffold ID | Ga0073907_1135158 Open in IMG/M |
Source Dataset Name | Mouse cecum microbial communities from Vienna, Austria - Glucosamine amended microcosms incubated with D2O |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 562 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Mouse Cecum → Mouse Cecum Microbial Communities From Vienna, Austria |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Austria: Vienna | |||||||
Coordinates | Lat. (o) | 48.2 | Long. (o) | 16.37 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051936 | Metagenome | 143 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073907_11351582 | F051936 | N/A | QEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK* |
⦗Top⦘ |