Scaffold Ga0073907_1135158

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073907_1135158

Scaffold Ga0073907_1135158

Overview

Basic Information
Taxon OID	3300005469 Open in IMG/M
Scaffold ID	Ga0073907_1135158 Open in IMG/M
Source Dataset Name	Mouse cecum microbial communities from Vienna, Austria - Glucosamine amended microcosms incubated with D2O
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	562
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Mouse Cecum → Mouse Cecum Microbial Communities From Vienna, Austria

Source Dataset Sampling Location
Location Name	Austria: Vienna
Coordinates	Lat. (^o)	48.2	Long. (^o)	16.37	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073907_11351582	F051936	N/A	QEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFVMLIIRYLSIHISIKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.