| Basic Information | |
|---|---|
| Taxon OID | 3300005377 Open in IMG/M |
| Scaffold ID | Ga0074217_10463 Open in IMG/M |
| Source Dataset Name | Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 3_Base_of_chrolophyll_max_130m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 792 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Ocean at depths of 10m to 4000m at the Hawaii open-ocean time-series station | |||||||
| Coordinates | Lat. (o) | 22.45 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 130 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007891 | Metagenome / Metatranscriptome | 343 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074217_104632 | F007891 | N/A | MTLYSNFFSSAINSVETKEKEVLITYSSNIAKEYVYNCENVPEFTNNLCSVLISNELQQDGGSVGSFVSQSRRDGVLTDQ* |
| ⦗Top⦘ |