Scaffold Ga0074245_190

Overview

Basic Information

• Taxon OID: 3300005371
• Scaffold ID: Ga0074245_190
• Source Dataset Name: Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer Sample 10335
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 28885
• Total Scaffold Genes: 27
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 16 (59.26%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Source Dataset Sampling Location

• Location Name: Late winter and summer Antarctic waters
• Coordinates
  • Lat. (^o): -64.067
  • Long. (^o): -64.767

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033598	Metagenome / Metatranscriptome	177	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0074245_19018	F033598	AGTAG	LAPLDIASRLRAPLPAKGSIIVLSAISNCSQLKRVSLILPGEGRSPSASGKLNFLPLRFPAIILKVLSLIRLK*