3300005371: Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer Sample 10335

Overview

Basic Information

• IMG/M Taxon OID: 3300005371
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0056601 | Gp0051591 | Ga0074245
• Sample Name: Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer Sample 10335
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1866435
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine neritic zone → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Late winter and summer Antarctic waters
• Coordinates
  • Lat. (^o): -64.067
  • Long. (^o): -64.767
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033598	Metagenome / Metatranscriptome	177	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0074245_190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	28885

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074245_190	Ga0074245_19018	F033598	LAPLDIASRLRAPLPAKGSIIVLSAISNCSQLKRVSLILPGEGRSPSASGKLNFLPLRFPAIILKVLSLIRLK*