Scaffold Ga0074234_1109

Overview

Basic Information

• Taxon OID: 3300005342
• Scaffold ID: Ga0074234_1109
• Source Dataset Name: Hot spring viral communities from Yellowstone National Park, Wyoming, USA - Nymph Lake
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3648
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring → Hot Spring Viral Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Nymph Lake, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7523206
  • Long. (^o): -110.7253926

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075084	Metagenome / Metatranscriptome	119	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0074234_11091	F075084	GAGG	MRPCHKDLCLMYSLGVDYARLLDFTEQNPTGKLFRRAERAMIYARRLLASWYGYDTRMLMETALRRILKKSIIYCNLVKRLGLESQYCKRYTYYDEVPCELVTEYDVEVAYADIMHMITNYNNETTSEILTNMTKECSTYEVR*