| Basic Information | |
|---|---|
| Taxon OID | 3300005300 Open in IMG/M |
| Scaffold ID | Ga0072500_147505 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Great Boiling Spring, Nevada - cellulolytic enrichment S 77C |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1645 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Great Boiling Spring, Nevada | |||||||
| Coordinates | Lat. (o) | 40.71458 | Long. (o) | -119.369659 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028182 | Metagenome / Metatranscriptome | 192 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0072500_1475053 | F028182 | N/A | MPKVSISEAARRLDTTEEVIREWIRLGLLDVEPPPAKPRRTRELNLAFQPTSATPEPKVDLEQLYEVAEREGWLLLSLEAWDAADSEP* |
| ⦗Top⦘ |