Scaffold Ga0072500_147505

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0072500_147505

Scaffold Ga0072500_147505

Overview

Basic Information
Taxon OID	3300005300 Open in IMG/M
Scaffold ID	Ga0072500_147505 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from Great Boiling Spring, Nevada - cellulolytic enrichment S 77C
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1645
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada

Source Dataset Sampling Location
Location Name	Great Boiling Spring, Nevada
Coordinates	Lat. (^o)	40.71458	Long. (^o)	-119.369659	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028182	Metagenome / Metatranscriptome	192	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0072500_1475053	F028182	N/A	MPKVSISEAARRLDTTEEVIREWIRLGLLDVEPPPAKPRRTRELNLAFQPTSATPEPKVDLEQLYEVAEREGWLLLSLEAWDAADSEP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.