| Basic Information | |
|---|---|
| Taxon OID | 3300005286 Open in IMG/M |
| Scaffold ID | Ga0065721_10013402 Open in IMG/M |
| Source Dataset Name | Mesophilic microbial community from rice straw/compost enrichment Sample: eDNA_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4207 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost → Rice-Straw Enriched Compost Microbial Community From Berkeley |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Davis, California, USA | |||||||
| Coordinates | Lat. (o) | 38.5402727 | Long. (o) | -121.7500776 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101365 | Metagenome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065721_100134023 | F101365 | N/A | MYLNKHLIYWINRFPKTMSIELEDLMEALRYKLPGFEMEGTEFRGGFEIFIRLEGVTYINDDGLERQHYIVVTADSIRNAIRIYIYKEEKLTAGFDLIREPFCAVMQAVREYVKEHQAVDKLIGKFI* |
| ⦗Top⦘ |