| Basic Information | |
|---|---|
| Taxon OID | 3300005274 Open in IMG/M |
| Scaffold ID | Ga0065724_113561 Open in IMG/M |
| Source Dataset Name | Thermophilic enriched microbial communities from mini bioreactor at UC Davis - Sample SG0.5JP960 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1038 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Grass → Composting → Bioreactor → Switchgrass Adapted Compost → Switchgrass Adapted Compost Microbial Communities From Mini Bioreactor At Uc Davis |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of California, Davis, USA | |||||||
| Coordinates | Lat. (o) | 38.546 | Long. (o) | -121.7533 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036417 | Metagenome / Metatranscriptome | 170 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065724_1135612 | F036417 | N/A | MIQPARVPLRTRIPTVLVRLATDEGEIAFRARWRRSARELHHIILFKMRQGRPLWFQDEWGHDLVFRPECVWAAMVDGR* |
| ⦗Top⦘ |