| Basic Information | |
|---|---|
| Taxon OID | 3300005264 Open in IMG/M |
| Scaffold ID | Ga0073581_113972 Open in IMG/M |
| Source Dataset Name | Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4572. Combined assembly of Gp0115316 and Gp0146562 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas, Austin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5606 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (37.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Hydrothermal Sediment Microbial Communities From Guaymas Basin, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guaymus Basin | |||||||
| Coordinates | Lat. (o) | 27.013056 | Long. (o) | -111.519722 | Alt. (m) | Depth (m) | 0 to .12 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076639 | Metagenome | 118 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073581_1139723 | F076639 | N/A | MKNSEIKKGQDRAPILWMHEAITYLGLDRLGLTRPDKAMYRLIKKGALHPKKIAGHFAFDKSELDIVVANGDQKRGRGRPKKIHSA* |
| ⦗Top⦘ |