| Basic Information | |
|---|---|
| Taxon OID | 3300005261 Open in IMG/M |
| Scaffold ID | Ga0071345_1003922 Open in IMG/M |
| Source Dataset Name | Freshwater pond sediment microbial communities from Midddleton WI, HA 3/4 enriched by Glucose under anaerobic conditions -HA Sample 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 37443 |
| Total Scaffold Genes | 41 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (26.83%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humic Acid And/Or Glucose Under Anaerobic Conditions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Middleton, WI | |||||||
| Coordinates | Lat. (o) | 43.0603 | Long. (o) | -89.5717 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043160 | Metagenome / Metatranscriptome | 157 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0071345_10039229 | F043160 | N/A | MAKKNFDNLKNSHLGGGLSNLIPEMNENHDSKKTKVVYKDVPKTFLMVLEDYEYLQTYSRYMAFHSNSKYPLKRSLSDAIKLLREAHPEIQ* |
| ⦗Top⦘ |