Scaffold Ga0074071_1019035

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074071_1019035

Scaffold Ga0074071_1019035

Overview

Basic Information
Taxon OID	3300005258 Open in IMG/M
Scaffold ID	Ga0074071_1019035 Open in IMG/M
Source Dataset Name	Microbial communities on the surface of bentonite enhanced biochar
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Australian Centre for Ecogenomics
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1506
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Bentonite Enhanced Biochar

Source Dataset Sampling Location
Location Name	Sydney
Coordinates	Lat. (^o)	-33.917926	Long. (^o)	151.235347	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080191	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074071_10190353	F080191	N/A	MQDVRWPLLKRLLLDDGWQWREDTLFAPHETMWFTTSSETPNYAEFRDRMSETLEEVDQGELHADLVSLVTALDCVLRGN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.