NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074076_100071

Scaffold Ga0074076_100071


Overview

Basic Information
Taxon OID3300005257 Open in IMG/M
Scaffold IDGa0074076_100071 Open in IMG/M
Source Dataset NameHot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19513
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (60.53%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Marsarchaeota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.733Long. (o)-110.709Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006070Metagenome / Metatranscriptome382N
F026924Metagenome / Metatranscriptome196Y
F027904Metagenome / Metatranscriptome193N

Sequences

Protein IDFamilyRBSSequence
Ga0074076_10007129F027904GGAGGVEHKYEPPDYDLFNLNNGSTTIGTSPVTLLYEGQPNAAVYDPPDLTLRVKQVIIQNTTSSPITVQLLAVAAPNTTLPSPIPKTPPIPVNANSAVTLSEDEWSISIRAGYALAAVSSAASSANVFAKCYFTKGTGSPA*
Ga0074076_10007133F006070AGGMTLYRYLVVDLPIRDTNTHTYRTDPFDPLIPTQPGISLVRLGESVPPVRAFNIYVYNFANAALNVQMIANENAKNYAFGNLLDGLNYFTEESYPDFNVGSAVTVPAGSLSTPSVEAIQSDFYKDAAERYLSVALTYSATPTSGFVRAHIDLFYEGF*
Ga0074076_1000717F026924AGGAGGMSVGKVCWREHYKFEASKIVHLGRHGFHIPVIVYGHDPDPEKAQEDLCINVYGFYEPIGSFRENQLILPPKKGVRVEQEG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.