Scaffold Ga0073692_1028110

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073692_1028110

Scaffold Ga0073692_1028110

Overview

Basic Information
Taxon OID	3300005238 Open in IMG/M
Scaffold ID	Ga0073692_1028110 Open in IMG/M
Source Dataset Name	Microbial communities on the surface of aged kaolinite enhanced biochar from soil in Sydney, Australia
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Australian Centre for Ecogenomics
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	939
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Biochar

Source Dataset Sampling Location
Location Name	Sydney
Coordinates	Lat. (^o)	-33.91794	Long. (^o)	151.235369	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024411	Metagenome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073692_10281101	F024411	AGGAG	MCPLCMTNVAVVVAGATSGAGMLGYVAVKVRALRRHRREPRTPQLDSKKNKQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.