Scaffold Ga0073350_113696

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073350_113696

Scaffold Ga0073350_113696

Overview

Basic Information
Taxon OID	3300005223 Open in IMG/M
Scaffold ID	Ga0073350_113696 Open in IMG/M
Source Dataset Name	Sylvan Springs Unknown 12.1A - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Stanford University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	916
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.699217	Long. (^o)	-110.767467	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062913	Metagenome / Metatranscriptome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073350_1136962	F062913	N/A	MERSRAVEVFSNINCEGNTQIISIINRALELIRGGECDRAYNELRKLSMFL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.