| Basic Information | |
|---|---|
| Taxon OID | 3300005192 Open in IMG/M |
| Scaffold ID | Ga0073159_1009446 Open in IMG/M |
| Source Dataset Name | E5 T9 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Alicante |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 804 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Mallorca 2014 E5 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Salinas de Campos (Mallorca) | |||||||
| Coordinates | Lat. (o) | 39.338015 | Long. (o) | 3.051796 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089940 | Metagenome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073159_10094461 | F089940 | AGGA | MKYLSAFFIVLGLSIVIGAEAQDWFPMFAAQIGLGVVTLIAGGLFASQIEIENER* |
| ⦗Top⦘ |