| Basic Information | |
|---|---|
| Taxon OID | 3300005100 Open in IMG/M |
| Scaffold ID | Ga0072724_105916 Open in IMG/M |
| Source Dataset Name | Cold seep microbial communities from the Ulleung Basin, East Sea, Korea - Hemire mound |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Macrogen |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6389 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (88.89%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Cold Seeps → Unclassified → Cold Seep → Cold Seep Microbial Communities From The Ulleung Basin, East Sea, Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hemire Mound, Ulleung Basin East Sea, Korea | |||||||
| Coordinates | Lat. (o) | 36.098 | Long. (o) | 130.0788 | Alt. (m) | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102576 | Metagenome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0072724_1059168 | F102576 | AGGAGG | MNDLLMLEKYFPGGSLDGGLELANRLDWGLTVQMAGLEYVVSSGDEPILRTDSKDALQTFIYGLGLAYAVLPEDLFLGLEAALEEL* |
| ⦗Top⦘ |