Scaffold Ga0072503_157593

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0072503_157593

Scaffold Ga0072503_157593

Overview

Basic Information
Taxon OID	3300005096 Open in IMG/M
Scaffold ID	Ga0072503_157593 Open in IMG/M
Source Dataset Name	Hydrothermal chimney microbial communities from the East Pacific Rise - M vent 7
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2538
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Chimney In Epr

Source Dataset Sampling Location
Location Name	East Pacific Rise
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048675	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072503_1575932	F048675	AGGAG	MDKHLEKDEVLFCEHYAAAQSLKNAWTRLASTYGCMMVVLSGKTLIIKPHWFAGWLIYLLGLDLCHEIPVTNIRKVTETGVWSKYGKVELHFRSAEGQDKRVLLYLTKSREFVDRLADAIRKT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.