NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0072503_129132

Scaffold Ga0072503_129132


Overview

Basic Information
Taxon OID3300005096 Open in IMG/M
Scaffold IDGa0072503_129132 Open in IMG/M
Source Dataset NameHydrothermal chimney microbial communities from the East Pacific Rise - M vent 7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)27624
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (64.29%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Chimney In Epr

Source Dataset Sampling Location
Location NameEast Pacific Rise
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074900Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0072503_12913216F074900AGGAGMTAKIINLADPDEREHAFATVEEAERALAAMVEKFKTQGYRVEEQRPPNEKYPQFAVYDFGDAWIGTYTIEL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.