Basic Information | |
---|---|
Taxon OID | 3300005080 Open in IMG/M |
Scaffold ID | Ga0069611_10081870 Open in IMG/M |
Source Dataset Name | Combined Assembly of Gp0111534, Gp0111535, Gp0111536, Gp0111537, Gp0111539, Gp0111540, Gp0111541, Gp0111542, Gp0111543 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Michigan |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1176 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Bioreactor → Activated Sludge Wastewater Microbial Communities From Ann Arbor, Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ann Arbor, MI | |||||||
Coordinates | Lat. (o) | 42.293023 | Long. (o) | -83.713393 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069722 | Metagenome / Metatranscriptome | 123 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0069611_100818701 | F069722 | AGG | MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQER* |
⦗Top⦘ |