Basic Information | |
---|---|
Taxon OID | 3300005077 Open in IMG/M |
Scaffold ID | Ga0071116_1065573 Open in IMG/M |
Source Dataset Name | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Pennsylvania State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2125 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole → Water Filled Karst Sinkhole Microbial Communities From Little Salt Spring, North Port, Florida |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Port, Florida | |||||||
Coordinates | Lat. (o) | 27.074722 | Long. (o) | -82.233333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059000 | Metagenome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0071116_10655733 | F059000 | N/A | YLMAQSISLISEATWAPRMLIRSRYAITDIGFFPWKQFMAITVTDTNGVLI* |
⦗Top⦘ |