| Basic Information | |
|---|---|
| Family ID | F059000 |
| Family Type | Metagenome |
| Number of Sequences | 134 |
| Average Sequence Length | 49 residues |
| Representative Sequence | AQSISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTIVVTDAAQLLN |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.03 % |
| % of genes from short scaffolds (< 2000 bps) | 84.33 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified bacterial viruses (52.239 % of family members) |
| NCBI Taxonomy ID | 12333 |
| Taxonomy | All Organisms → Viruses → unclassified bacterial viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater (11.940 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.313 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (47.761 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.74% Coil/Unstructured: 80.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF05670 | NFACT-R_1 | 36.57 |
| PF01370 | Epimerase | 6.72 |
| PF06831 | H2TH | 1.49 |
| PF00303 | Thymidylat_synt | 1.49 |
| PF07453 | NUMOD1 | 1.49 |
| PF00186 | DHFR_1 | 0.75 |
| PF00535 | Glycos_transf_2 | 0.75 |
| PF12796 | Ank_2 | 0.75 |
| PF07460 | NUMOD3 | 0.75 |
| PF00145 | DNA_methylase | 0.75 |
| PF13419 | HAD_2 | 0.75 |
| PF08722 | Tn7_TnsA-like_N | 0.75 |
| PF06114 | Peptidase_M78 | 0.75 |
| PF08545 | ACP_syn_III | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1293 | Ribosome quality control (RQC) protein RqcH, Rqc2/NEMF/Tae2 family, contains fibronectin-(FbpA) and RNA- (NFACT) binding domains | Translation, ribosomal structure and biogenesis [J] | 36.57 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 1.49 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 1.49 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.75 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.28 % |
| Unclassified | root | N/A | 6.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001605|Draft_10075643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2604 | Open in IMG/M |
| 3300001968|GOS2236_1093757 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 643 | Open in IMG/M |
| 3300002195|metazooDRAFT_1226888 | Not Available | 818 | Open in IMG/M |
| 3300002198|metazooDRAFT_1229879 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 578 | Open in IMG/M |
| 3300002476|metazooDRAFT_10793614 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 583 | Open in IMG/M |
| 3300002835|B570J40625_100802485 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 827 | Open in IMG/M |
| 3300002835|B570J40625_100987452 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 721 | Open in IMG/M |
| 3300004054|Ga0063232_10072779 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 935 | Open in IMG/M |
| 3300004240|Ga0007787_10112385 | All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium | 1282 | Open in IMG/M |
| 3300005077|Ga0071116_1065573 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300005527|Ga0068876_10135740 | All Organisms → Viruses | 1452 | Open in IMG/M |
| 3300005584|Ga0049082_10083778 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1119 | Open in IMG/M |
| 3300005662|Ga0078894_10093192 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2647 | Open in IMG/M |
| 3300005662|Ga0078894_10571675 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 1009 | Open in IMG/M |
| 3300005827|Ga0074478_1121378 | Not Available | 502 | Open in IMG/M |
| 3300006484|Ga0070744_10014102 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2370 | Open in IMG/M |
| 3300006484|Ga0070744_10023786 | All Organisms → Viruses → Predicted Viral | 1815 | Open in IMG/M |
| 3300006484|Ga0070744_10024856 | All Organisms → Viruses → Predicted Viral | 1775 | Open in IMG/M |
| 3300006484|Ga0070744_10045161 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 1294 | Open in IMG/M |
| 3300006484|Ga0070744_10080937 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 941 | Open in IMG/M |
| 3300006805|Ga0075464_10039179 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2570 | Open in IMG/M |
| 3300006805|Ga0075464_10623267 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 665 | Open in IMG/M |
| 3300007516|Ga0105050_10332334 | Not Available | 921 | Open in IMG/M |
| 3300007516|Ga0105050_10332335 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 921 | Open in IMG/M |
| 3300007542|Ga0099846_1331354 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 518 | Open in IMG/M |
| 3300007548|Ga0102877_1034976 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1465 | Open in IMG/M |
| 3300007559|Ga0102828_1179294 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 538 | Open in IMG/M |
| 3300007603|Ga0102921_1228315 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 668 | Open in IMG/M |
| 3300007611|Ga0102927_1309325 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 565 | Open in IMG/M |
| 3300007658|Ga0102898_1074021 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 778 | Open in IMG/M |
| 3300008107|Ga0114340_1077709 | All Organisms → Viruses | 1378 | Open in IMG/M |
| 3300008107|Ga0114340_1184641 | All Organisms → Viruses | 723 | Open in IMG/M |
| 3300008116|Ga0114350_1087033 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1022 | Open in IMG/M |
| 3300008258|Ga0114840_1077492 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300008448|Ga0114876_1050572 | All Organisms → Viruses | 1879 | Open in IMG/M |
| 3300009026|Ga0102829_1112518 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 855 | Open in IMG/M |
| 3300009026|Ga0102829_1341117 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 503 | Open in IMG/M |
| 3300009059|Ga0102830_1114045 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 798 | Open in IMG/M |
| 3300009059|Ga0102830_1152073 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 679 | Open in IMG/M |
| 3300009149|Ga0114918_10115065 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1648 | Open in IMG/M |
| 3300009149|Ga0114918_10369886 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 787 | Open in IMG/M |
| 3300009159|Ga0114978_10115327 | Not Available | 1759 | Open in IMG/M |
| 3300009164|Ga0114975_10469838 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 680 | Open in IMG/M |
| 3300009181|Ga0114969_10291727 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 965 | Open in IMG/M |
| 3300009183|Ga0114974_10392179 | Not Available | 797 | Open in IMG/M |
| 3300009419|Ga0114982_1061842 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1172 | Open in IMG/M |
| 3300009502|Ga0114951_10034229 | All Organisms → cellular organisms → Bacteria | 3213 | Open in IMG/M |
| 3300009687|Ga0116144_10618149 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 525 | Open in IMG/M |
| 3300010158|Ga0114960_10201642 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 1038 | Open in IMG/M |
| 3300010338|Ga0116245_10354985 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 763 | Open in IMG/M |
| 3300010354|Ga0129333_10112287 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2514 | Open in IMG/M |
| 3300010885|Ga0133913_10473593 | Not Available | 3303 | Open in IMG/M |
| 3300010885|Ga0133913_10639612 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2789 | Open in IMG/M |
| 3300010885|Ga0133913_11041261 | All Organisms → Viruses → Predicted Viral | 2113 | Open in IMG/M |
| 3300010885|Ga0133913_11042079 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2112 | Open in IMG/M |
| 3300010885|Ga0133913_13007603 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1124 | Open in IMG/M |
| 3300011187|Ga0136596_1017509 | All Organisms → Viruses → Predicted Viral | 1812 | Open in IMG/M |
| 3300012533|Ga0138256_11300959 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 536 | Open in IMG/M |
| 3300012667|Ga0157208_10021919 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 858 | Open in IMG/M |
| 3300012667|Ga0157208_10024685 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 807 | Open in IMG/M |
| 3300012667|Ga0157208_10035267 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 673 | Open in IMG/M |
| 3300013005|Ga0164292_10858012 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 571 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10353572 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1022 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10826651 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 609 | Open in IMG/M |
| 3300014050|Ga0119952_1070643 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 880 | Open in IMG/M |
| 3300015214|Ga0172382_11074023 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 529 | Open in IMG/M |
| 3300017778|Ga0181349_1053542 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1578 | Open in IMG/M |
| 3300018410|Ga0181561_10425502 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 601 | Open in IMG/M |
| 3300019487|Ga0187893_10105497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2461 | Open in IMG/M |
| 3300020162|Ga0211735_11058929 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1049 | Open in IMG/M |
| 3300020162|Ga0211735_11362224 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1040 | Open in IMG/M |
| 3300020205|Ga0211731_10489864 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 2041 | Open in IMG/M |
| 3300020562|Ga0208597_1048952 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 805 | Open in IMG/M |
| 3300020572|Ga0207909_1013200 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1599 | Open in IMG/M |
| 3300020575|Ga0208053_1049829 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 787 | Open in IMG/M |
| 3300020721|Ga0214236_1041065 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 590 | Open in IMG/M |
| 3300020727|Ga0214246_1035676 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 778 | Open in IMG/M |
| 3300021132|Ga0214196_1044529 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 581 | Open in IMG/M |
| 3300021963|Ga0222712_10050499 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 3111 | Open in IMG/M |
| 3300021963|Ga0222712_10336482 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 935 | Open in IMG/M |
| 3300023174|Ga0214921_10519533 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 559 | Open in IMG/M |
| 3300023179|Ga0214923_10313937 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 845 | Open in IMG/M |
| 3300023313|Ga0256748_1136928 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 703 | Open in IMG/M |
| 3300024262|Ga0210003_1072824 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1647 | Open in IMG/M |
| 3300024346|Ga0244775_10146428 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
| 3300024346|Ga0244775_10155355 | All Organisms → Viruses → Predicted Viral | 1930 | Open in IMG/M |
| 3300024509|Ga0255175_1036993 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 940 | Open in IMG/M |
| 3300025547|Ga0209556_1062848 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 882 | Open in IMG/M |
| 3300025667|Ga0209043_1145869 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 590 | Open in IMG/M |
| 3300025678|Ga0208695_1018635 | All Organisms → Viruses → Predicted Viral | 3208 | Open in IMG/M |
| 3300025867|Ga0209098_1360248 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 541 | Open in IMG/M |
| 3300025896|Ga0208916_10432655 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 574 | Open in IMG/M |
| 3300027278|Ga0208439_1066746 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 673 | Open in IMG/M |
| 3300027531|Ga0208682_1054867 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300027631|Ga0208133_1006219 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 3478 | Open in IMG/M |
| 3300027631|Ga0208133_1026943 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1453 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1328377 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 506 | Open in IMG/M |
| 3300027733|Ga0209297_1000124 | Not Available | 50850 | Open in IMG/M |
| 3300027734|Ga0209087_1340442 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 521 | Open in IMG/M |
| 3300027769|Ga0209770_10149415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 942 | Open in IMG/M |
| 3300027785|Ga0209246_10185099 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 816 | Open in IMG/M |
| 3300027892|Ga0209550_10118102 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1948 | Open in IMG/M |
| 3300027973|Ga0209298_10315870 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300028374|Ga0306906_1028032 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 990 | Open in IMG/M |
| 3300029442|Ga0239579_1061575 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 559 | Open in IMG/M |
| 3300029914|Ga0311359_10736237 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 701 | Open in IMG/M |
| 3300029989|Ga0311365_10276910 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1447 | Open in IMG/M |
| 3300030339|Ga0311360_10734825 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300031578|Ga0307376_10648983 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 667 | Open in IMG/M |
| 3300031758|Ga0315907_10204904 | All Organisms → Viruses | 1651 | Open in IMG/M |
| 3300031758|Ga0315907_10255764 | All Organisms → Viruses | 1451 | Open in IMG/M |
| 3300031758|Ga0315907_11026181 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 593 | Open in IMG/M |
| 3300031787|Ga0315900_10270367 | All Organisms → Viruses | 1434 | Open in IMG/M |
| 3300031787|Ga0315900_10454803 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 988 | Open in IMG/M |
| 3300031787|Ga0315900_10670713 | Not Available | 741 | Open in IMG/M |
| 3300031857|Ga0315909_10283930 | All Organisms → Viruses | 1248 | Open in IMG/M |
| 3300031857|Ga0315909_10800347 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 596 | Open in IMG/M |
| 3300031951|Ga0315904_10075334 | All Organisms → Viruses | 3637 | Open in IMG/M |
| 3300031963|Ga0315901_10098365 | All Organisms → Viruses | 2710 | Open in IMG/M |
| 3300031963|Ga0315901_10192313 | All Organisms → Viruses | 1775 | Open in IMG/M |
| 3300032050|Ga0315906_10034402 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 5444 | Open in IMG/M |
| 3300032050|Ga0315906_10263742 | All Organisms → Viruses | 1574 | Open in IMG/M |
| 3300032093|Ga0315902_10664040 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 858 | Open in IMG/M |
| 3300032116|Ga0315903_10393228 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1132 | Open in IMG/M |
| 3300032116|Ga0315903_10475946 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 994 | Open in IMG/M |
| 3300032562|Ga0316226_1136122 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1095 | Open in IMG/M |
| 3300033552|Ga0326734_1181205 | Not Available | 526 | Open in IMG/M |
| 3300033992|Ga0334992_0496196 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 529 | Open in IMG/M |
| 3300034018|Ga0334985_0104832 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 1994 | Open in IMG/M |
| 3300034022|Ga0335005_0230862 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 1132 | Open in IMG/M |
| 3300034060|Ga0334983_0434563 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 749 | Open in IMG/M |
| 3300034102|Ga0335029_0455994 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 755 | Open in IMG/M |
| 3300034105|Ga0335035_0171619 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1354 | Open in IMG/M |
| 3300034168|Ga0335061_0023726 | All Organisms → Viruses | 3269 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.70% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.72% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 6.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.73% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.99% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.99% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.99% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 2.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.24% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.24% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.49% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.49% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.49% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.49% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.75% |
| Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.75% |
| Ice | Environmental → Aquatic → Freshwater → Ice → Glacier → Ice | 0.75% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.75% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.75% |
| Hydrothermal Fe-Rich Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat | 0.75% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.75% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.75% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.75% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.75% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.75% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.75% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.75% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300002198 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUL 2013 | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007611 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010338 | AD_JPMRca | Engineered | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011187 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897 | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020721 | Freshwater microbial communities from Trout Bog Lake, WI - 28JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021132 | Freshwater microbial communities from Trout Bog Lake, WI - 25AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023313 | Hydrothermal Fe-rich mat microbial community from Urashima Vent Field, Mariana Arc, Pacific Ocean - 801-BM1-B4 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
| 3300025547 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025667 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025678 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025867 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028374 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897 (v2) | Environmental | Open in IMG/M |
| 3300029442 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM13 | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300033552 | Glacier ice microbial communities from Ngari, Tibet, China - 15_GP2_131.5 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_100756431 | 3300001605 | Hydrocarbon Resource Environments | DQPGILFIPYLMAQSISLISEATWAPRMLIRSRYAVADIGFFPEKQFMAIKVTDANGVLI |
| GOS2236_10937572 | 3300001968 | Marine | LMAQSISIISEATFAPRMLLRSRYAVAEIGWFPQKQFMTIKVTDAAQLLN* |
| metazooDRAFT_12268883 | 3300002195 | Lake | FAPRMLLRSRYAVTEVGWYPQKQFMTIKVSDVKGLLN* |
| metazooDRAFT_12298791 | 3300002198 | Lake | SISLISEATFAPRMLLRSRYAVAEVGWYPQKQYMTIQVKDASVYLN* |
| metazooDRAFT_107936142 | 3300002476 | Lake | ATFAPRMLLRSRYAVAEVGWYPQKQFMTIVVNDAAQYLN* |
| B570J40625_1008024851 | 3300002835 | Freshwater | LSEATFAPRMLLRSRYAVAEVGWYPQKQYMTIQVKDANSYLN* |
| B570J40625_1009874521 | 3300002835 | Freshwater | ISEATFAPRMLLRSRYAVAEVGWFPQKQFMTIKVTDLAGLLN* |
| Ga0063232_100727791 | 3300004054 | Freshwater Lake | VPYLMAQSISIISEATFAPRMLLRSRYAVTEVGWYPQKQFMTINVIDANQYLN* |
| Ga0007787_101123852 | 3300004240 | Freshwater Lake | YLMAQSISVISEATFAPRMLLRSRYAVAEVGWFPQKQFMTINVTDETQLLN* |
| Ga0071116_10655733 | 3300005077 | Sinkhole | YLMAQSISLISEATWAPRMLIRSRYAITDIGFFPWKQFMAITVTDTNGVLI* |
| Ga0068876_101357401 | 3300005527 | Freshwater Lake | ISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDNAQLLN* |
| Ga0049082_100837781 | 3300005584 | Freshwater Lentic | QPGIVFVPYLMAQSISVISEATFAPRLLLRSRYAVTDVGWYPQKQYMTITVTDANQLLN* |
| Ga0078894_100931921 | 3300005662 | Freshwater Lake | QSISVISEATFAPRMLLRSRYAVAEVGWFPHKQFMTIKVNDESELLN* |
| Ga0078894_105716753 | 3300005662 | Freshwater Lake | IIFVPYLMAQSISVISEATFAPRMLLRSRYAVTEVGWFPQKQYMTITVTDSAQLLN* |
| Ga0074478_11213782 | 3300005827 | Sediment (Intertidal) | GVIFIPYLMAQNITLMNPQTWTPSMLIRSRYAVSEIGFFPWKQFMSIHVTDSNGTLI* |
| Ga0070744_100141023 | 3300006484 | Estuarine | FAPRMLLRSRYAVAEVGWYPQKQFMTIVVKDTNSYLN* |
| Ga0070744_100237861 | 3300006484 | Estuarine | ATFAPRMLLRSRYAVAEVGWFPQKQFMTLVVTDAAQYLN* |
| Ga0070744_100248561 | 3300006484 | Estuarine | LMAQSISVISEATFAPRMLLRSRYAVTEVGWFPQKQYMTITVTDAAQLLN* |
| Ga0070744_100451613 | 3300006484 | Estuarine | SIISEATFAPRMLLRSRYAVTEVGWFPQKQFMTIVVSDARGLLN* |
| Ga0070744_100809373 | 3300006484 | Estuarine | QSISVISEATFAPRMLLRSRYAVAEVGWFPQKQFMTLVVTDSAQYLN* |
| Ga0075464_100391791 | 3300006805 | Aqueous | LMAQSISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTIKVTDAAQLLN* |
| Ga0075464_106232671 | 3300006805 | Aqueous | LMAQSISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTITVTDAAQLLN* |
| Ga0105050_103323341 | 3300007516 | Freshwater | SISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTIQVTDANQLLN* |
| Ga0105050_103323351 | 3300007516 | Freshwater | SISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTIQVTDVNQLLN* |
| Ga0099846_13313542 | 3300007542 | Aqueous | ISEATFAPRMLLRSRYAVAEVGWFPQKQFMTIQVTDDAQLLN* |
| Ga0102877_10349764 | 3300007548 | Estuarine | SISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDGNQLLN* |
| Ga0102828_11792942 | 3300007559 | Estuarine | QSISVISEATFAPRMLLRSRYAVTEVGWYPQKQYMTITVTDAAQLLN* |
| Ga0102921_12283152 | 3300007603 | Estuarine | PYLMAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDTNQLLN* |
| Ga0102927_13093251 | 3300007611 | Pond Water | LMAQSISLLSEATFAPRMLLRSRYAVAELGFYPQKQYMTIRVTDGSNILA* |
| Ga0102898_10740213 | 3300007658 | Estuarine | LIFIPYLMAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDGNQLLN* |
| Ga0114340_10777091 | 3300008107 | Freshwater, Plankton | IPYLMAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDASQLLN* |
| Ga0114340_11846411 | 3300008107 | Freshwater, Plankton | IPYLMAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDNAQLLN* |
| Ga0114350_10870332 | 3300008116 | Freshwater, Plankton | MAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYITIVVTDNAQLLN* |
| Ga0114840_10774921 | 3300008258 | Freshwater, Plankton | MAQSISLISEATFAPRMLLRSRYAVAEVGWFPQKQFMTIKVSDSYGLLN* |
| Ga0114876_10505724 | 3300008448 | Freshwater Lake | ISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDASQLLN* |
| Ga0102829_11125182 | 3300009026 | Estuarine | YLMAQSISVISEATFAPRMLLRSRYAVAEVGWFPQKQFMTLVVTDVKQLLN* |
| Ga0102829_13411171 | 3300009026 | Estuarine | ISVISEATFAPRMLLRSRYAVAEVGWFPQKQFMTIKVTDASQLLN* |
| Ga0102830_11140453 | 3300009059 | Estuarine | AQSISIISEATFAPRMLLRSRYAVTEVGWFPQKQFMTIKVKDVENFLN* |
| Ga0102830_11520731 | 3300009059 | Estuarine | DQPGIIFVPYLMAQSISVISEATFAPRMLLRSRYAVTEVGWFPQKQFLTIKVSDSAGLLN |
| Ga0114918_101150655 | 3300009149 | Deep Subsurface | ISEATFAPRMLLRSRYAVGELGWYPQKQYMTIYVADPQQILV* |
| Ga0114918_103698861 | 3300009149 | Deep Subsurface | VPYLMAQSISLISEATWAPRMLIRSRYAIADIGFFPHKQFMTIQVTDTQGVLI* |
| Ga0114978_101153271 | 3300009159 | Freshwater Lake | ATFAPRMLLRSRYAVAEVGWYPQKQYMTIKVSDTPGLLN* |
| Ga0114975_104698383 | 3300009164 | Freshwater Lake | ISLISEATFAPRLLLRSRYAIAEVGWYPQKQFMTIGVFDPNILLN* |
| Ga0114969_102917271 | 3300009181 | Freshwater Lake | RMLLRSRYAVAEVGWFPQKQFMTLVVTDSAQYLN* |
| Ga0114974_103921791 | 3300009183 | Freshwater Lake | ISIISEATFAPRMLLRSRYAVAEVGWYPQKQYMTIKVSDTPGLLN* |
| Ga0114982_10618421 | 3300009419 | Deep Subsurface | LMAQSISLISEATFAPRLLLRSRYAVAEVGWYPQKQFMTISVVDGKGLLN* |
| Ga0114951_100342296 | 3300009502 | Freshwater | LFIPYLMAQSISLISEATWAPRMLIRSRYAVSDIGFFPEKQYMCIQVTDTHGYLI* |
| Ga0116144_106181492 | 3300009687 | Anaerobic Digestor Sludge | SVISEATFAPRMLLRSRYAVAEVGWFPQKQFMTIRVTDAAQLLN* |
| Ga0114960_102016423 | 3300010158 | Freshwater Lake | PYLMAQSISVISEATFAPRMLLRSRYAVTEVGWYPQKQYMTITVTDTAQLLN* |
| Ga0116245_103549851 | 3300010338 | Anaerobic Digestor Sludge | QPGIIFVPYLMAQSISVISEATFAPRMLLRSRYAIAEVGWFPQKQYMTIHVTDAAGYLN* |
| Ga0129333_101122871 | 3300010354 | Freshwater To Marine Saline Gradient | AQSISIISEATFAPRMLLRSRYAVTEVGWYPQKQYMTINVTDTNGYLN* |
| Ga0133913_104735931 | 3300010885 | Freshwater Lake | APRMLLRSRYAVSEVGWYPQKQYMTLKVSDTAGLLN* |
| Ga0133913_106396124 | 3300010885 | Freshwater Lake | AQSISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTIVVTDAAQLLN* |
| Ga0133913_110412611 | 3300010885 | Freshwater Lake | YLMAQSISIISEATFAPRMLLRSRYAVTEVGWYPQKQFMTIKVSDTKGLLN* |
| Ga0133913_110420791 | 3300010885 | Freshwater Lake | YLMAQSISIISEATFAPRMLLRSRYAVTEVGWYPQKQFMTIQVSDSLGLLN* |
| Ga0133913_130076033 | 3300010885 | Freshwater Lake | AQSISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTITVTDAKQYLN* |
| Ga0136596_10175091 | 3300011187 | Saline Lake | ATFAPRMLLRSRYAIAELGFYPQKQYMTVKVVDTNNILA* |
| Ga0138256_113009591 | 3300012533 | Active Sludge | PYLMAQSISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTINVTDAAQLLN* |
| Ga0157208_100219193 | 3300012667 | Freshwater | TFAPRMLLRSRYAVAEVGWFPQKQFMTLVVTDANQYLN* |
| Ga0157208_100246853 | 3300012667 | Freshwater | TFAPRMLLRSRYAVAEVGWYPQKQFMTLVVTDAAQYLN* |
| Ga0157208_100352672 | 3300012667 | Freshwater | VISEATFAPRMLLRSRYAVAEVGWFPQKQFMTIKVTDVDQLLN* |
| Ga0164292_108580122 | 3300013005 | Freshwater | FVPYLMAQSISVISEATFAPRMLLRSRYAVTEVGWFPQKQYMTITVTDAGQLLN* |
| (restricted) Ga0172372_103535721 | 3300013132 | Freshwater | GIIFVPYLMAQSISIISEATFAPRMLLRSRYAVTEVGWYPHKQYMTINVTDASGFLN* |
| (restricted) Ga0172371_108266511 | 3300013138 | Freshwater | PGIIFVPYLMAQSISIISEATFAPRMLLRSRYAVTEVGWYPHKQYMTINVTDGEGYLN* |
| Ga0119952_10706432 | 3300014050 | Freshwater | SEATFAPRMLLRSRYAVAEVGWFPQKQFMTIVVKDEDQFLK* |
| Ga0172382_110740231 | 3300015214 | Landfill Leachate | PGLLFLPYLMAQSISLISEATWAPRMLIRSRYAVSDVGFFPEKQFMAINVKDNGGYLS* |
| Ga0181349_10535424 | 3300017778 | Freshwater Lake | ISEATFAPRLLLRSRYAVAEVGWYPQKQFMTISVVDNGGFLN |
| Ga0181561_104255021 | 3300018410 | Salt Marsh | PGLIFVPYLMAQSISVISEATFAPRMLLRSRYAVAEVGWFPQKQYMEIKVLDATPSLN |
| Ga0187893_101054973 | 3300019487 | Microbial Mat On Rocks | FIPYLMAQSISLISEATRAPRLFLRSRYTIAEIGFFPHKQYLVVNVTDAGNYLV |
| Ga0211735_110589292 | 3300020162 | Freshwater | PRMLLRSRYAVTEVGWYPQKQFMTINVIDANQFLN |
| Ga0211735_113622242 | 3300020162 | Freshwater | PRMLLRSRYAVTEVGWYPQKQFMTINVIDANQYLN |
| Ga0211731_104898644 | 3300020205 | Freshwater | MAQSISVISEATFAPRMLLRSRYAVAEVGWFPQKQFMTIKVKDDAQLLN |
| Ga0208597_10489523 | 3300020562 | Freshwater | YLMAQSISVISEATFAPRMLLRSRYAVTEVGWFPQKQYMTITVTDAAQLLN |
| Ga0207909_10132003 | 3300020572 | Freshwater | SISVISEATFAPRMLLRSRYAVAEIGWYPQKQFMVINVTDAGGFLN |
| Ga0208053_10498293 | 3300020575 | Freshwater | SEATFAPRMLLRSRYAVAEVGWFPQKQFMTLVVTDANQYLN |
| Ga0214236_10410652 | 3300020721 | Freshwater | FVPYLMAQSIQLISEATWAPRMLIRSRYAVADIGFFPWKQFMTIKVTDSMGVLI |
| Ga0214246_10356761 | 3300020727 | Freshwater | DQPGIIFVPYLMAQSISVISEATFAPRMLLRSRYAVAEVGWFPQKQFMTIQVKDAAQLLN |
| Ga0214196_10445291 | 3300021132 | Freshwater | PGLVFVPYLMAQSIQLISEATWAPRMLIRSRYAVADIGFFPWKQFMTIKVTDSMGVLI |
| Ga0222712_100504994 | 3300021963 | Estuarine Water | VPYLMAQSISVISEATFAPRMLLRSRYAVTEVGWYPQKQYMTITVTDAAQLLN |
| Ga0222712_103364821 | 3300021963 | Estuarine Water | AQSISVISEATFAPRMLLRSRYAVTEVGWYPQKQYMTITVTDENQLLN |
| Ga0214921_105195331 | 3300023174 | Freshwater | PYLMAQSISLLSEATFAPRLLLRSRYAVTEVGWYPQKQFMQINVTDAAQLLN |
| Ga0214923_103139373 | 3300023179 | Freshwater | AQSISLISEATFAPRLLLRSRYAVAEVGWYPQKQFMTLSVVDSNQFLN |
| Ga0256748_11369281 | 3300023313 | Hydrothermal Fe-Rich Mat | PRMLLRSRYAIGELGWYPQKQYMTVHVADPDQILI |
| Ga0210003_10728245 | 3300024262 | Deep Subsurface | LMAQSISIISEATFAPRMLLRSRYAVGELGWYPQKQYMTIYVADPQQILV |
| Ga0244775_101464281 | 3300024346 | Estuarine | PDQPGIIFVPYLMAQSISVISEATFAPRMLLRSRYAVTEVGWFPQKQYMTITVTDAAQLL |
| Ga0244775_101553551 | 3300024346 | Estuarine | PDQPGIIFVPYLMAQSISVISEATFAPRMLLRSRYAVTEVGWYPQKQYMTITVTDAKQFL |
| Ga0255175_10369933 | 3300024509 | Freshwater | VISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDANQLLN |
| Ga0209556_10628481 | 3300025547 | Marine | LMAQSISVISEATFAPRMLLRSRYAVTEVGWFPQKQFMTIEVTDVNTLLN |
| Ga0209043_11458691 | 3300025667 | Marine | APRMLLRSRYAVTEVGWFPQKQFMTIEVTDVNTLLN |
| Ga0208695_10186351 | 3300025678 | Anaerobic Digestor Sludge | IVFIPYLMAQNISIISEATFAPRMLLRSRYAIGELGWFPQKQYFKIKVYDSKQVLV |
| Ga0209098_13602483 | 3300025867 | Anaerobic Digestor Sludge | VFIPYLMAQSISLISEATWAPRMLIRSRYAVSDIGFFPEKQFMGIAVTDTHGFLI |
| Ga0208916_104326551 | 3300025896 | Aqueous | VPYLMAQSISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTITVTDAAQLLN |
| Ga0208439_10667462 | 3300027278 | Estuarine | AQSISVISEATFAPRMLLRSRYAVTEVGWYPQKQYMTITVTDTNQLLN |
| Ga0208682_10548671 | 3300027531 | Estuarine | SISVISEATFAPRMLLRSRYAVTEVGWYPQKQYMTITVTDDAQLLN |
| Ga0208133_10062195 | 3300027631 | Estuarine | QPGIIFVPYLMAQSISVISEATFAPRMLLRSRYAVAEVGWFPQKQFMTLVVTDVRQLLN |
| Ga0208133_10269431 | 3300027631 | Estuarine | SIISEATFAPRMLLRSRYAVTEVGWFPQKQFMTIVVSDARGLLN |
| (restricted) Ga0247833_13283771 | 3300027730 | Freshwater | IFIPYLMAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDTAQYLN |
| Ga0209297_10001241 | 3300027733 | Freshwater Lake | PDQPGIIFVPYLMAQSISIISEATFAPRMLLRSRYAVAEVGWYPQKQYMTIKVSDTPGLL |
| Ga0209087_13404422 | 3300027734 | Freshwater Lake | ISIISEATFAPRMLLRSRYAVAEVGWYPQKQYMTIKVSDTPGLLN |
| Ga0209770_101494153 | 3300027769 | Freshwater Lake | PGIIFVPYLMAQSISVISEATFAPRMLLRSRYAVTEVGWFPQKQYMTIQVLDEAQLLN |
| Ga0209246_101850992 | 3300027785 | Freshwater Lake | FVPYLMAQSISIISEATFAPRMLLRSRYAVTEVGWYPQKQFMTINVIDANQYLN |
| Ga0209550_101181021 | 3300027892 | Freshwater Lake | GIIFVPYLMAQSISIISEATFAPRMLLRSRYAVTEVGWYPQKQFMTINVIDANQYLN |
| Ga0209298_103158701 | 3300027973 | Freshwater Lake | MAQSISVISEATFAPRMLLRSRYAVAEVGWYPQKQFMTITVTDDAQYLN |
| Ga0306906_10280322 | 3300028374 | Saline Lake | ATFAPRMLLRSRYAIAELGFYPQKQYMTVKVVDTNNILA |
| Ga0239579_10615751 | 3300029442 | Freshwater Lake | GLVFIPYLMAQSISLISEATWAPRMLIRSRYAVSDIGFFPEKQFMGIAVTDTHGYLI |
| Ga0311359_107362372 | 3300029914 | Bog | LVFVPYLMAQSIQLISEATWAPRMLIRSRYAVADIGFFPWKQFMTILVTDSAGVLI |
| Ga0311365_102769101 | 3300029989 | Fen | PGLVFVPYLMAQSIQLISEATWAPRMLIRSRYAVADIGFFPWKQFMTLLVTDSAGVLI |
| Ga0311360_107348251 | 3300030339 | Bog | VFVPYLMAQSIQLISEATWAPRMLIRSRYAVADIGFFPWKQFMTILVTDTAGVLI |
| Ga0307376_106489831 | 3300031578 | Soil | LLFLPYLMAQSISLISEATWAPRMLIRSRYAVADVGFFPEKQFLAIHVTDQNGYLI |
| Ga0315907_102049041 | 3300031758 | Freshwater | QSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDASQLLN |
| Ga0315907_102557644 | 3300031758 | Freshwater | ISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDNAQLLN |
| Ga0315907_110261812 | 3300031758 | Freshwater | MAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDTNTLLN |
| Ga0315900_102703674 | 3300031787 | Freshwater | VISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDNAQLLN |
| Ga0315900_104548031 | 3300031787 | Freshwater | DQPGLIFVPYLMAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDNNQLLN |
| Ga0315900_106707132 | 3300031787 | Freshwater | FVPYLMAQSISLISEATFAPRMLLRSRYAIAEVGWYPQKQFMTISVVDEKNFLN |
| Ga0315909_102839301 | 3300031857 | Freshwater | SEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDNAQLLN |
| Ga0315909_108003473 | 3300031857 | Freshwater | QPGIIFVPYLMAQSINLISEATFAPRMLLRSRYAVAEVGWYPQKQFMTISVVDSKNLLN |
| Ga0315904_100753341 | 3300031951 | Freshwater | SVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDNAQLLN |
| Ga0315901_100983655 | 3300031963 | Freshwater | GLIFIPYLMAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDNAQLLN |
| Ga0315901_101923131 | 3300031963 | Freshwater | GLIFIPYLMAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDANQLLN |
| Ga0315906_100344028 | 3300032050 | Freshwater | QSISLISEATFAPRMLLRSRYAIAEVGWYPQKQFMTISVVDEKNFLN |
| Ga0315906_102637421 | 3300032050 | Freshwater | GLIFIPYLMAQSISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDASQLLN |
| Ga0315902_106640402 | 3300032093 | Freshwater | SISVISEATFAPRMLLRSRYAIADVGFFPEKQYMTIVVTDNNQLLN |
| Ga0315903_103932281 | 3300032116 | Freshwater | APRMLLRSRYAVAEVGWYPQKQFMTISVVDSKNLLN |
| Ga0315903_104759463 | 3300032116 | Freshwater | YLMAQSISVISEATFAPRMLLRSRYAVAEVGWFPQKQFMTIVVTDTPQYLN |
| Ga0316226_11361223 | 3300032562 | Freshwater | PGIIFVPYLMAQSISIISEATFAPRMLLRSRYAVAEVGWYPQKQFMTIVVNDAAQYLN |
| Ga0326734_11812051 | 3300033552 | Ice | MTSEATGAPKMLLRSRYAVTEVGYFPHKQYMTMYVTDTKNILA |
| Ga0334992_0496196_48_197 | 3300033992 | Freshwater | MAQSISVISEATFAPRMLLRSRYAVAEIGWYPQKQFMTINVTDAAGFLN |
| Ga0334985_0104832_1853_1993 | 3300034018 | Freshwater | SISVISEATFAPRMLLRSRYAVAEIGWYPQKQFMTINVTDAAGFLN |
| Ga0335005_0230862_22_171 | 3300034022 | Freshwater | MAQSISVISEATFAPRMLLRSRYAVTEVGWFPQKQYMTITVTDAAQLLN |
| Ga0334983_0434563_568_717 | 3300034060 | Freshwater | MAQSISVISEATFAPRMLLRSRYAVAEIGWFPQKQFMLINVTDASGLLN |
| Ga0335029_0455994_23_172 | 3300034102 | Freshwater | MAQSISVISEATFAPRMLLRSRYAVAEVGWFPQKQYMTIVTKDASGYLN |
| Ga0335035_0171619_1193_1342 | 3300034105 | Freshwater | MAQTVKIISEATFAPRMLLRSRYAVAELGFFPQKQYLTISVTDVANRLA |
| Ga0335061_0023726_63_212 | 3300034168 | Freshwater | MAQSIKLISEATFAPRMLLRSRYAVTEVGFFPQKQYMTILVKDTNNNLA |
| ⦗Top⦘ |