Basic Information | |
---|---|
Taxon OID | 3300005039 Open in IMG/M |
Scaffold ID | Ga0068519_1033577 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Nanji, Korea with extracellular vesicles - Nanji-3um |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chunlab, Inc |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 846 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Nanji, South Korea | |||||||
Coordinates | Lat. (o) | 37.3132 | Long. (o) | 126.828 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046373 | Metagenome / Metatranscriptome | 151 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068519_10335771 | F046373 | GGAGG | MINTFIAEFHCFVVAHNNVDDYRICELNDGNELSSLLPYFEQFDTYELALARVPVEFRPNDEQL* |
⦗Top⦘ |