NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068519_1018971

Scaffold Ga0068519_1018971


Overview

Basic Information
Taxon OID3300005039 Open in IMG/M
Scaffold IDGa0068519_1018971 Open in IMG/M
Source Dataset NameWastewater microbial communities from Nanji, Korea with extracellular vesicles - Nanji-3um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1132
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location NameNanji, South Korea
CoordinatesLat. (o)37.3132Long. (o)126.828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040068Metagenome / Metatranscriptome162N
F082613Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0068519_10189711F082613N/ALAWNITITSSANISGVDITFVYLDAQQNQQTLTVAGPNTTTKDAGIYASKIISVTTSASASNISIGHTNVGYAPWKVIPSRGVSSTTGASIGIDGTANITLQTTFANIADNAIFAGTFDVFSHSYLAALTASAFDTIDTREIGVRLKFNSWSSGNVRLDLSVSAKG*
Ga0068519_10189712F040068AGGAMARSVPKCKRAAYVYDRDFIVVDDISGVLKMRSECAIDGYGFLSSQGDIRNPQETPPIIREQMAAWPDPRPIGQPVFVPSPDYQYFIFNYFIVSVQSRATTFDATATVGLNAPIASMDWYVDDVYVVSGLIPTVTMMGGVHTISVLITDDYGNQQTFSFEYEQGIDLGFNFITGEYFYFIDDVQFDFIG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.