Scaffold Ga0070794_102360

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0070794_102360

Scaffold Ga0070794_102360

Overview

Basic Information
Taxon OID	3300004930 Open in IMG/M
Scaffold ID	Ga0070794_102360 Open in IMG/M
Source Dataset Name	Simulated microbial communities from King Abdullah University of Science and Technology - simArt49e
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Heinrich Heine University of Dusseldorf
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8214
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From King Abdullah University Of Science And Technology

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010244	Metagenome / Metatranscriptome	306	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070794_1023602	F010244	AGAAGG	VKYKVMFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.