3300004930: Simulated microbial communities from King Abdullah University of Science and Technology - simArt49e

Overview

Basic Information

• IMG/M Taxon OID: 3300004930
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114547 | Gp0113131 | Ga0070794
• Sample Name: Simulated microbial communities from King Abdullah University of Science and Technology - simArt49e
• Sequencing Status: Permanent Draft
• Sequencing Center: Heinrich Heine University of Dusseldorf
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 142826939
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Simulated Microbial Communities From King Abdullah University Of Science And Technology
• Type: Engineered
• Taxonomy: Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From King Abdullah University Of Science And Technology

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): na → na → na

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010244	Metagenome / Metatranscriptome	306	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0070794_102360	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	8214

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0070794_102360	Ga0070794_1023602	F010244	VKYKVMFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL*