| Basic Information | |
|---|---|
| Taxon OID | 3300004870 Open in IMG/M |
| Scaffold ID | Ga0071103_121943 Open in IMG/M |
| Source Dataset Name | Mid-Atlantic Ridge North Pond Expedition - Sample Bottom Water CTD 2012 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 930 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pond, Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 22.78 | Long. (o) | -46.09 | Alt. (m) | Depth (m) | 4350 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097503 | Metagenome / Metatranscriptome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0071103_1219432 | F097503 | AGGA | MDCDTFDHVVEMFEQKMIEGCIANEFKCVYTEETGEFVAEINGKFYVAMIREKK* |
| ⦗Top⦘ |