Basic Information | |
---|---|
Taxon OID | 3300004833 Open in IMG/M |
Scaffold ID | Ga0071101_137856 Open in IMG/M |
Source Dataset Name | Mid-Atlantic Ridge North Pond Expedition - Sample 1383C Deep |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 533 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pond, Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 22.8 | Long. (o) | -46.05 | Alt. (m) | Depth (m) | 200 to 332 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001583 | Metagenome / Metatranscriptome | 668 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0071101_1378561 | F001583 | N/A | FTNKHLNSDQLLRLMLFHYFTP*YYLYLIQLHLLFCHESWDADSGENTIEDKSGSYIS*FYDAFLKEIQDA*F*TIIVYVFF*FHVIEPLIINYFYFER*NISEYDEIRFYGVAPH*YFRPLMGLLVVSPTHYEGLF*LVMFFILLTFLPVIYGFYNNNENNSIILPMKITKFQTFF |
⦗Top⦘ |