Scaffold Ga0068515_125053

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068515_125053

Scaffold Ga0068515_125053

Overview

Basic Information
Taxon OID	3300004829 Open in IMG/M
Scaffold ID	Ga0068515_125053 Open in IMG/M
Source Dataset Name	Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chunlab, Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	745
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location Name	South Korea: Pohang-si, Gyeongsangbuk-do
Coordinates	Lat. (^o)	36.03776	Long. (^o)	129.386	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087023	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068515_1250532	F087023	N/A	TLSQVDIIFDNMTFNQDIFITHNEKAGSGKINYYIELEQFRLDLNENTVATLKDIRNIKSQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.