| Basic Information | |
|---|---|
| Taxon OID | 3300004819 Open in IMG/M |
| Scaffold ID | Ga0070914_100949 Open in IMG/M |
| Source Dataset Name | Hypersaline lake viral communities from Bras del Port, Santa Pola, Alicante, Spain - HQ1 dirigido Enero 2015 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Alicante |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 858 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Lake → Hypersaline Lake Viral Communities From Bras Del Port, Santa Pola, Alicante, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Santa Pola Alicante | |||||||
| Coordinates | Lat. (o) | 38.19317 | Long. (o) | -0.59268 | Alt. (m) | Depth (m) | 56.6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088354 | Metagenome | 109 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0070914_1009491 | F088354 | AGGAGG | MTDTPRAELDVDRFETTTVNANGQVYLGRDLEGVKVHVAIEIVTDDDEQEDPE* |
| ⦗Top⦘ |