Scaffold Ga0068404_109558

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068404_109558

Scaffold Ga0068404_109558

Overview

Basic Information
Taxon OID	3300004760 Open in IMG/M
Scaffold ID	Ga0068404_109558 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Formosa Ridge, South China Sea G1-3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	648
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Cold Seeps → Sediment → Marine Sediment → Metagenomics Analysis Of Sediments Collected From Formosa Ridge

Source Dataset Sampling Location
Location Name	South China Sea, offshore southwestern Taiwan
Coordinates	Lat. (^o)	22.11546667	Long. (^o)	119.28443333	Alt. (m)		Depth (m)	1146
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040581	Metagenome / Metatranscriptome	161	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0068404_1095582	F040581	AGAAG	MEFLENFNGIKFMGNGNVYNGYLNQEQTWKEYREWALKNIYE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.