| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004760 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114441 | Gp0111474 | Ga0068404 |
| Sample Name | Marine sediment microbial communities from Formosa Ridge, South China Sea G1-3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 7517288 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Metagenomics Analysis Of Sediments Collected From Formosa Ridge |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Cold Seeps → Sediment → Marine Sediment → Metagenomics Analysis Of Sediments Collected From Formosa Ridge |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South China Sea, offshore southwestern Taiwan | |||||||
| Coordinates | Lat. (o) | 22.11546667 | Long. (o) | 119.28443333 | Alt. (m) | N/A | Depth (m) | 1146 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040581 | Metagenome / Metatranscriptome | 161 | N |
| F058159 | Metagenome | 135 | N |
| F104423 | Metagenome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0068404_100962 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 544 | Open in IMG/M |
| Ga0068404_109558 | Not Available | 648 | Open in IMG/M |
| Ga0068404_110851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0068404_100962 | Ga0068404_1009621 | F104423 | VEVHRIRKAKSLYHRERYHILLEVEKDRWLEIESLNGVTYDSIQTFLKSEKETGIRVVGFTDKSFQWGTIKDWNHSGIIKNLKIKK* |
| Ga0068404_109558 | Ga0068404_1095582 | F040581 | MEFLENFNGIKFMGNGNVYNGYLNQEQTWKEYREWALKNIYE* |
| Ga0068404_110851 | Ga0068404_1108512 | F058159 | MDLATRDQVIELLQSEIDKTQETVLDYLEEAKNVQNENEFLEGVTNDYKRYHNYILAEKERERKQLETLIGYLDKVLQEAGLSAEMANRARFQQNQILGEMDKIKGELDR |
| ⦗Top⦘ |