NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066616_1011090

Scaffold Ga0066616_1011090


Overview

Basic Information
Taxon OID3300004637 Open in IMG/M
Scaffold IDGa0066616_1011090 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_150m_RNA (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1862
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameBritish Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)150
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001048Metagenome / Metatranscriptome793Y
F018265Metagenome / Metatranscriptome236Y
F051476Metagenome / Metatranscriptome144N

Sequences

Protein IDFamilyRBSSequence
Ga0066616_10110901F018265GAGMSMEKYTLRAVSITQNILELQKVNRELVTVRKIVTELEQRKMELISS*
Ga0066616_10110903F051476GAGMTHWKVKLIIKDKLHKAELFEKLSDARLWAMKEAKLAVSHTMFNKTDIVADITSHEFA*
Ga0066616_10110904F001048GAGGMKIVSTKQFWWRFNYLKRNGGEITVTDRTPEMDVKEFNRIELLVNSRVRWELGPENFMKWDSCGYKDIPTLAKAYGIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.