Scaffold Ga0066906_11145914

Overview

Basic Information

• Taxon OID: 3300004634
• Scaffold ID: Ga0066906_11145914
• Source Dataset Name: High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-1D-10D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 543
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location

• Location Name: Joint BioEnergy Institute, California, USA
• Coordinates
  • Lat. (^o): 38.5402
  • Long. (^o): -121.75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031319	Metagenome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066906_111459141	F031319	GGA	MFNEIDSDFDDVAISTFKLSLPAEYDIRKSLTGKPVTSIHQLMDRIDKYKRVEED*