| Basic Information | |
|---|---|
| Taxon OID | 3300004634 Open in IMG/M |
| Scaffold ID | Ga0066906_11025476 Open in IMG/M |
| Source Dataset Name | High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-1D-10D |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 575 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Joint BioEnergy Institute, California, USA | |||||||
| Coordinates | Lat. (o) | 38.5402 | Long. (o) | -121.75 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031319 | Metagenome | 182 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066906_110254761 | F031319 | N/A | MSMREGETLKTNSDRYWEMFNEIEGEHDNVAISTSKAGLPVEHDLRKSLTGKPVTSVHQLMDRIDKYRRVEEDQL |
| ⦗Top⦘ |