NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066906_10024456

Scaffold Ga0066906_10024456


Overview

Basic Information
Taxon OID3300004634 Open in IMG/M
Scaffold IDGa0066906_10024456 Open in IMG/M
Source Dataset NameHigh solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-1D-10D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3047
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location
Location NameJoint BioEnergy Institute, California, USA
CoordinatesLat. (o)38.5402Long. (o)-121.75Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031319Metagenome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0066906_100244564F031319N/AMFNEIDGDFDDVVISTFKVGFPTEHDLRKSLTGKLVTSVRQLMDRVDKYKRVEEDMAEVRKD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.