Scaffold Ga0066906_10011526

Overview

Basic Information

• Taxon OID: 3300004634
• Scaffold ID: Ga0066906_10011526
• Source Dataset Name: High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-1D-10D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4314
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location

• Location Name: Joint BioEnergy Institute, California, USA
• Coordinates
  • Lat. (^o): 38.5402
  • Long. (^o): -121.75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087072	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066906_1001152613	F087072	GAGG	MKSKVFTKRMFSLELSEEELSIIAGALYCANSEDIKCFVDKYKYPCAGYNFDEIAELKDRLSEEINKIIESK*