NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070399_1002641

Scaffold Ga0070399_1002641


Overview

Basic Information
Taxon OID3300004628 Open in IMG/M
Scaffold IDGa0070399_1002641 Open in IMG/M
Source Dataset NameMicrobial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 4 (version 1)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16905
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (87.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa

Source Dataset Sampling Location
Location NameLawrence Berkeley National Laboratory, California, USA
CoordinatesLat. (o)37.8754404Long. (o)-122.2477251Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086460Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0070399_10026414F086460GGAMLRHAPNPSSVKTMRLSAVLLLLATTLFAAPPTWKPASFSGLIIGQGRRQDAVRLLGTPDAFQRTRSGEELTYRARGDHKGDLTVRLDPSGIVVEVQEAFPIAIPRTQIYKEFGKDALTAHFSRAKCASDALYRNPRGVIELTLYPSRGIVLWPDQNGYDFAAILYTAKQPGLSRPPACMATVKH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.