NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0069718_15394624

Scaffold Ga0069718_15394624


Overview

Basic Information
Taxon OID3300004481 Open in IMG/M
Scaffold IDGa0069718_15394624 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0112041, Gp0112042, Gp0112043
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe National High-throughput DNA Sequencing Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)590
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Urban Pond Sediment Microbial Communities From Copenhagen, Denmark

Source Dataset Sampling Location
Location NameCopenhagen, Denmark
CoordinatesLat. (o)55.685937Long. (o)12.574205Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047674Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0069718_153946241F047674N/AMDMDTETIEEVDEAIFHAYLTRSQTRDSQKHIIDKLIDDLLDSRLELMQC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.