| Basic Information | |
|---|---|
| Family ID | F047674 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MDTETIQEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 51.68 % |
| % of genes near scaffold ends (potentially truncated) | 29.53 % |
| % of genes from short scaffolds (< 2000 bps) | 79.19 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.72 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (87.248 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (18.121 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.034 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.416 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.58% β-sheet: 0.00% Coil/Unstructured: 43.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.72 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.2.7.4: Methicillin resistance protein FemA probable tRNA-binding arm | d1lrza1 | 1lrz | 0.90658 |
| a.246.1.1: Hyaluronidase post-catalytic domain-like | d2choa1 | 2cho | 0.90269 |
| a.2.6.1: HR1 repeat | d1cxzb_ | 1cxz | 0.90154 |
| a.25.1.1: Ferritin | d1vjxa1 | 1vjx | 0.8904 |
| a.30.6.1: HP1531-like | d1zkea1 | 1zke | 0.88619 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF02945 | Endonuclease_7 | 38.26 |
| PF01844 | HNH | 10.74 |
| PF13481 | AAA_25 | 2.68 |
| PF00145 | DNA_methylase | 2.01 |
| PF01555 | N6_N4_Mtase | 1.34 |
| PF14279 | HNH_5 | 1.34 |
| PF11598 | COMP | 0.67 |
| PF05135 | Phage_connect_1 | 0.67 |
| PF01370 | Epimerase | 0.67 |
| PF04586 | Peptidase_S78 | 0.67 |
| PF12705 | PDDEXK_1 | 0.67 |
| PF04860 | Phage_portal | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.01 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.34 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.34 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.34 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.99 % |
| Unclassified | root | N/A | 2.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000558|Draft_10018156 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
| 3300002362|B570J29607_100945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1633 | Open in IMG/M |
| 3300002408|B570J29032_109873964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1850 | Open in IMG/M |
| 3300003393|JGI25909J50240_1042871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300003429|JGI25914J50564_10013653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2534 | Open in IMG/M |
| 3300003490|JGI25926J51410_1054113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300003491|JGI25924J51412_1008229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1991 | Open in IMG/M |
| 3300003493|JGI25923J51411_1021181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1314 | Open in IMG/M |
| 3300004054|Ga0063232_10097518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300004282|Ga0066599_100469028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300004448|Ga0065861_1117095 | All Organisms → cellular organisms → Bacteria | 3613 | Open in IMG/M |
| 3300004481|Ga0069718_15394624 | Not Available | 590 | Open in IMG/M |
| 3300004793|Ga0007760_11345392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300004836|Ga0007759_11552637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300005517|Ga0070374_10169367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300005517|Ga0070374_10214051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
| 3300005527|Ga0068876_10208085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1133 | Open in IMG/M |
| 3300005527|Ga0068876_10220306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300005528|Ga0068872_10641875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300005662|Ga0078894_10574909 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300005805|Ga0079957_1059875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2270 | Open in IMG/M |
| 3300006484|Ga0070744_10138802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300006805|Ga0075464_10251817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1056 | Open in IMG/M |
| 3300006805|Ga0075464_10315297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300006805|Ga0075464_10321460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300006805|Ga0075464_10769116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300007974|Ga0105747_1245983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300008107|Ga0114340_1089638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
| 3300008107|Ga0114340_1158493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300008107|Ga0114340_1175040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300008107|Ga0114340_1269907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300008108|Ga0114341_10011042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8734 | Open in IMG/M |
| 3300008108|Ga0114341_10016041 | All Organisms → cellular organisms → Bacteria | 5469 | Open in IMG/M |
| 3300008113|Ga0114346_1009817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5512 | Open in IMG/M |
| 3300008113|Ga0114346_1203478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300008116|Ga0114350_1051637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1492 | Open in IMG/M |
| 3300008117|Ga0114351_1084323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1891 | Open in IMG/M |
| 3300008120|Ga0114355_1037666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2325 | Open in IMG/M |
| 3300008266|Ga0114363_1037643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1997 | Open in IMG/M |
| 3300008266|Ga0114363_1077568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1247 | Open in IMG/M |
| 3300008266|Ga0114363_1091591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1111 | Open in IMG/M |
| 3300008266|Ga0114363_1202302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300008448|Ga0114876_1023622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3133 | Open in IMG/M |
| 3300008448|Ga0114876_1138741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300008448|Ga0114876_1140202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300008450|Ga0114880_1020590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3077 | Open in IMG/M |
| 3300009039|Ga0105152_10163316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| 3300009039|Ga0105152_10355391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300009068|Ga0114973_10179654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
| 3300009081|Ga0105098_10160691 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300009085|Ga0105103_10396213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300009152|Ga0114980_10286115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300009154|Ga0114963_10096333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1813 | Open in IMG/M |
| 3300009158|Ga0114977_10252414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
| 3300009159|Ga0114978_10042146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3194 | Open in IMG/M |
| 3300009160|Ga0114981_10216977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
| 3300009165|Ga0105102_10357224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300009169|Ga0105097_10771032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300009180|Ga0114979_10487764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300009183|Ga0114974_10535556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300009183|Ga0114974_10748912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300009184|Ga0114976_10243090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300009194|Ga0114983_1055214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300010885|Ga0133913_10008713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26515 | Open in IMG/M |
| 3300010885|Ga0133913_11357906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1811 | Open in IMG/M |
| 3300011009|Ga0129318_10342128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300012000|Ga0119951_1026890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1941 | Open in IMG/M |
| 3300012667|Ga0157208_10011273 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300013004|Ga0164293_10058794 | All Organisms → Viruses → Predicted Viral | 3066 | Open in IMG/M |
| 3300013004|Ga0164293_10211199 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
| 3300013005|Ga0164292_10200196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1422 | Open in IMG/M |
| 3300013005|Ga0164292_10915016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300013372|Ga0177922_10439824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300013372|Ga0177922_10978921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300013372|Ga0177922_11061086 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300017701|Ga0181364_1045949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300017761|Ga0181356_1001801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9192 | Open in IMG/M |
| 3300017780|Ga0181346_1103768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
| 3300019784|Ga0181359_1026494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2223 | Open in IMG/M |
| 3300019784|Ga0181359_1044620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1715 | Open in IMG/M |
| 3300019784|Ga0181359_1127364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300020048|Ga0207193_1037019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5448 | Open in IMG/M |
| 3300020159|Ga0211734_10119705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8644 | Open in IMG/M |
| 3300020161|Ga0211726_10227626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300020162|Ga0211735_11404654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1644 | Open in IMG/M |
| 3300020506|Ga0208091_1013959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300021438|Ga0213920_1051346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300021962|Ga0222713_10360012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300022190|Ga0181354_1085394 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300022752|Ga0214917_10001330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31837 | Open in IMG/M |
| 3300024343|Ga0244777_10296513 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300024346|Ga0244775_11364273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300024346|Ga0244775_11496116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300025843|Ga0209182_10237248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300027581|Ga0209651_1072256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300027644|Ga0209356_1186780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300027659|Ga0208975_1013504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2767 | Open in IMG/M |
| 3300027708|Ga0209188_1064544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
| 3300027721|Ga0209492_1000070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33220 | Open in IMG/M |
| 3300027736|Ga0209190_1016584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4211 | Open in IMG/M |
| 3300027741|Ga0209085_1127832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
| 3300027759|Ga0209296_1007562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6753 | Open in IMG/M |
| 3300027759|Ga0209296_1280944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300027764|Ga0209134_10036195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1612 | Open in IMG/M |
| 3300027764|Ga0209134_10305078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300027777|Ga0209829_10001024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23665 | Open in IMG/M |
| 3300027782|Ga0209500_10256507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300027792|Ga0209287_10126509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
| 3300027797|Ga0209107_10114254 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300027797|Ga0209107_10177801 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300027816|Ga0209990_10287509 | Not Available | 739 | Open in IMG/M |
| 3300027816|Ga0209990_10304047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300027899|Ga0209668_10058257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2109 | Open in IMG/M |
| 3300027971|Ga0209401_1040414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2185 | Open in IMG/M |
| 3300027974|Ga0209299_1241710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300028025|Ga0247723_1000358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31485 | Open in IMG/M |
| 3300028025|Ga0247723_1021645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2154 | Open in IMG/M |
| 3300028025|Ga0247723_1072521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300028392|Ga0304729_1000332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35050 | Open in IMG/M |
| 3300031758|Ga0315907_10175220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1808 | Open in IMG/M |
| 3300031784|Ga0315899_11548493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300031786|Ga0315908_11028009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300031787|Ga0315900_10416042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1054 | Open in IMG/M |
| 3300031787|Ga0315900_10526941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300031787|Ga0315900_10824709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300031857|Ga0315909_10150428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1918 | Open in IMG/M |
| 3300031857|Ga0315909_10351815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| 3300031857|Ga0315909_10389303 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300031857|Ga0315909_10939159 | Not Available | 529 | Open in IMG/M |
| 3300031951|Ga0315904_10761726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300031963|Ga0315901_10233175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1568 | Open in IMG/M |
| 3300031963|Ga0315901_10411890 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300031963|Ga0315901_11220711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300032050|Ga0315906_10056207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4074 | Open in IMG/M |
| 3300032092|Ga0315905_10907308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300032093|Ga0315902_10518722 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300032093|Ga0315902_11275141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300032116|Ga0315903_10015812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8584 | Open in IMG/M |
| 3300033981|Ga0334982_0001433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14966 | Open in IMG/M |
| 3300034022|Ga0335005_0117302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1720 | Open in IMG/M |
| 3300034022|Ga0335005_0678152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300034050|Ga0335023_0183873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1176 | Open in IMG/M |
| 3300034066|Ga0335019_0125590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1706 | Open in IMG/M |
| 3300034104|Ga0335031_0123733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1807 | Open in IMG/M |
| 3300034106|Ga0335036_0084826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2352 | Open in IMG/M |
| 3300034106|Ga0335036_0595882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300034120|Ga0335056_0375865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300034122|Ga0335060_0116000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1595 | Open in IMG/M |
| 3300034122|Ga0335060_0616724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.12% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 12.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.74% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.07% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.03% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.68% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 2.01% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.01% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.34% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.34% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.67% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.67% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.67% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.67% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.67% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.67% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.67% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.67% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.67% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.67% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.67% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300002362 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_100181565 | 3300000558 | Hydrocarbon Resource Environments | MDTETIQEIDEALAHAIITRANAIDSKKQSINDFINDLLDSRLELTNAKHCGNSR* |
| B570J29607_1009453 | 3300002362 | Freshwater | MDNDTETIEEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSK* |
| B570J29032_1098739642 | 3300002408 | Freshwater | MDNETETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSR* |
| JGI25909J50240_10428712 | 3300003393 | Freshwater Lake | MDVKTETLSEIDEALYHALISRKNSIDSKKHIVDRFIDELLDARIEVAKC* |
| JGI25914J50564_100136534 | 3300003429 | Freshwater Lake | MDTETIEEIDEALLHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC* |
| JGI25926J51410_10541132 | 3300003490 | Freshwater Lake | MDTETIQEIDEALSHAITTRANAIDSKKHIVDKFIDDLLDSRLE |
| JGI25924J51412_10082294 | 3300003491 | Freshwater Lake | MDTETIEEIDEALSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC* |
| JGI25923J51411_10211812 | 3300003493 | Freshwater Lake | MDMDTETIEEIDEALSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0063232_100975182 | 3300004054 | Freshwater Lake | MDMDMDTETIKEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTR* |
| Ga0066599_1004690283 | 3300004282 | Freshwater | MTPNNETIAEIDEALLHAIFTRQQSIDSKKHLVDKFIDDLLDSRLELSK* |
| Ga0065861_11170955 | 3300004448 | Marine | MSDIETLEEIDEALLHAYLTRQQTIDSKKHIVDKFIDDLLDSRLELTR* |
| Ga0069718_153946241 | 3300004481 | Sediment | MDMDTETIEEVDEAIFHAYLTRSQTRDSQKHIIDKLIDDLLDSRLELMQC* |
| Ga0007760_113453924 | 3300004793 | Freshwater Lake | VWALFVYGIGMDTETIQEIDEALSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0007759_115526373 | 3300004836 | Freshwater Lake | LGFTYLWMDMDTETIEEIDEALSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0070374_101693674 | 3300005517 | Freshwater Lake | MDTETIQEIDEALSHAVDTRTKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0070374_102140511 | 3300005517 | Freshwater Lake | MDTETIKEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTR* |
| Ga0068876_102080851 | 3300005527 | Freshwater Lake | MVWALFVYGLDMDTETIQEIDEALSHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0068876_102203062 | 3300005527 | Freshwater Lake | MDTETIQEIDEALSHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0068872_106418752 | 3300005528 | Freshwater Lake | MDMDTETIKEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTR* |
| Ga0078894_105749093 | 3300005662 | Freshwater Lake | MDMDTETIEEVDEAIFHAYLTRSHTIDSKKHIIDKLIDDLLDSRLELMQC* |
| Ga0079957_10598753 | 3300005805 | Lake | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSE* |
| Ga0070744_101388021 | 3300006484 | Estuarine | DTETIQEIDEALSHAVDTRTKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0075464_102518172 | 3300006805 | Aqueous | MSNNNETIAEIDEALLHAIFTRQQSIDSKKHLVDKFIDDLLDSRLELSQ* |
| Ga0075464_103152972 | 3300006805 | Aqueous | MDIDTETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELCK* |
| Ga0075464_103214601 | 3300006805 | Aqueous | MPQPETIAEIDEALMHAIFARQQSIDSKKHLIDKFIDDLLDSRLELTQ* |
| Ga0075464_107691161 | 3300006805 | Aqueous | NNNETIAEIDEALLHAIFTRQQSIDSKKHLVDKFIDDLLDSRLELSQ* |
| Ga0105747_12459832 | 3300007974 | Estuary Water | MDTETIQEIDEALSHAVDTRSKTIDSKKHIVDRFIDDLLDSRLELTK |
| Ga0114340_10896383 | 3300008107 | Freshwater, Plankton | MDMDMDTETIKEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLE |
| Ga0114340_11584932 | 3300008107 | Freshwater, Plankton | MDTETIQEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0114340_11750403 | 3300008107 | Freshwater, Plankton | MDMDMNTETIKEIDEALAHAVDTRSKTIDSKKHLVDKFIDDLLDSRLELTK* |
| Ga0114340_12699072 | 3300008107 | Freshwater, Plankton | LGFIHLWDKGMDTETIQEIDEALAHAVDTRAKAIDSKKHIIDKFIDDLLDTRLELTKC* |
| Ga0114341_100110422 | 3300008108 | Freshwater, Plankton | MVWALFVYGLDMDTETIQEIDEALSHAVDTRSKTIDSKKHIVDKFIDDLLVNS* |
| Ga0114341_100160416 | 3300008108 | Freshwater, Plankton | MDMDTETIEEVDEALSHAIITRANTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0114346_10098173 | 3300008113 | Freshwater, Plankton | MDTETIQEIDEALSHAIITRANAIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0114346_12034783 | 3300008113 | Freshwater, Plankton | MDMDTETIEEVDEAIFHAYLTRSHTIDSRKHIIDKLIDDLLDSRLELMQC* |
| Ga0114350_10516374 | 3300008116 | Freshwater, Plankton | MDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0114351_10843233 | 3300008117 | Freshwater, Plankton | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSK* |
| Ga0114355_10376663 | 3300008120 | Freshwater, Plankton | MDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDCRLELTKC* |
| Ga0114363_10376432 | 3300008266 | Freshwater, Plankton | MDMDTETIEEIDEALSHAIITRANAIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0114363_10775682 | 3300008266 | Freshwater, Plankton | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSQ* |
| Ga0114363_10915912 | 3300008266 | Freshwater, Plankton | MDTDTETIEEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSK* |
| Ga0114363_12023021 | 3300008266 | Freshwater, Plankton | MMMDTETETIEEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLE |
| Ga0114876_10236221 | 3300008448 | Freshwater Lake | MDTETIKEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLE |
| Ga0114876_11387412 | 3300008448 | Freshwater Lake | MQQLQLRLRTIQEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0114876_11402021 | 3300008448 | Freshwater Lake | KEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTK* |
| Ga0114880_10205904 | 3300008450 | Freshwater Lake | MDTETIQEIDEALAHAVDTRAKAIDSKKHIIDKFIDDLLDTRLELTKC* |
| Ga0105152_101633162 | 3300009039 | Lake Sediment | MNGEAMDATLETITEIDEALAYALATRKAARDSKKHLVDKFIDDLLDSRSALTKC* |
| Ga0105152_103553911 | 3300009039 | Lake Sediment | LTHAIATRKAARDSKKHLVDKFIDDLLDSRAQLTKC* |
| Ga0114973_101796542 | 3300009068 | Freshwater Lake | MSDIETLEEIDEALLHAYLTRQQTIDSKKHIVDKFIDDLLDSRLELTND* |
| Ga0105098_101606911 | 3300009081 | Freshwater Sediment | DEALSHAVDTRSKTIDSKKHIVDRFIDDLLDSRLELMQC* |
| Ga0105103_103962131 | 3300009085 | Freshwater Sediment | TIQEIDEALLHAINTRANTIDSKKHIVDKFIDDLLDSRLELTRC* |
| Ga0114980_102861152 | 3300009152 | Freshwater Lake | MPSHETIAEIDEALMHAIFARQQSIDSKKHLIDKFIDDLLDSRLELTQ* |
| Ga0114963_100963334 | 3300009154 | Freshwater Lake | MDKEMTSDIETVEEIDEALLHAYLTRKQTIDSKKHIVDKFIDDLLDSRLELTR* |
| Ga0114977_102524142 | 3300009158 | Freshwater Lake | MDIDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSE* |
| Ga0114978_100421463 | 3300009159 | Freshwater Lake | MAANNETIAEIDEALLHAIFTRQQSIDSKKHLVDKFIDDLLDSRLELSQ* |
| Ga0114981_102169772 | 3300009160 | Freshwater Lake | MIMDADTETIEEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSK* |
| Ga0105102_103572243 | 3300009165 | Freshwater Sediment | MDTETIQEIDEALLHAINTRANTIDSKKHIVDKFIDDLLDSRLELTRC* |
| Ga0105097_107710321 | 3300009169 | Freshwater Sediment | MDTETLKEIDEALAHAVDTRAKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0114979_104877642 | 3300009180 | Freshwater Lake | MDIDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSQ* |
| Ga0114974_105355561 | 3300009183 | Freshwater Lake | MSATNETIAEIDEALLHAIFTRQQSIDSKKHLVDKFIDDLLDSRLELSQ* |
| Ga0114974_107489121 | 3300009183 | Freshwater Lake | IDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSQ* |
| Ga0114976_102430902 | 3300009184 | Freshwater Lake | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSK* |
| Ga0114983_10552142 | 3300009194 | Deep Subsurface | MDMDMNTETIKEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTR* |
| Ga0133913_100087133 | 3300010885 | Freshwater Lake | MDSDIETLEEIDEALAHALITRKQSIDSKKHIVDKFIDDLLDSRLELTK* |
| Ga0133913_113579063 | 3300010885 | Freshwater Lake | MDADMNTETIQEIDEALMHAVNTRATTIDSKKHIVNKFIDDLLDSRLEIKDVEYISCN |
| Ga0129318_103421282 | 3300011009 | Freshwater To Marine Saline Gradient | MDIDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSK* |
| Ga0119951_10268904 | 3300012000 | Freshwater | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSQ* |
| Ga0157208_100112734 | 3300012667 | Freshwater | MDTETIQEIDEALAHAVDTRAKAIDSKKHIIDKFIDDLLDTRLELTNVEHCS* |
| Ga0164293_100587944 | 3300013004 | Freshwater | MDTETIQEIDEALSHAIDTRAKTIDSKKHIVDKFIDDLLDSRLELTRCSAFL* |
| Ga0164293_102111994 | 3300013004 | Freshwater | MDTETIQEIDEALSHAVDTRAKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0164292_102001962 | 3300013005 | Freshwater | MDNETETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSQ* |
| Ga0164292_109150163 | 3300013005 | Freshwater | FIYGIGMDTETIQEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0177922_104398243 | 3300013372 | Freshwater | DTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSQ* |
| Ga0177922_109789212 | 3300013372 | Freshwater | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDS |
| Ga0177922_110610862 | 3300013372 | Freshwater | MDTETIQEIDEALSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC* |
| Ga0181364_10459491 | 3300017701 | Freshwater Lake | LSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0181356_10018014 | 3300017761 | Freshwater Lake | LVGLFLLAYEMDVKTETLSEIDEALYHALISRKNSIDSKKHIVDRFIDELLDARIEVAKC |
| Ga0181346_11037682 | 3300017780 | Freshwater Lake | MDTETITEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTR |
| Ga0181359_10264944 | 3300019784 | Freshwater Lake | MDVKTETLSEIDEALYHALISRKNSIDSKKHIVDRFIDELLDARIEVAKC |
| Ga0181359_10446202 | 3300019784 | Freshwater Lake | MDMDTETIEEIDEALLHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0181359_11273642 | 3300019784 | Freshwater Lake | MDTETIQEIDEALSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0207193_10370195 | 3300020048 | Freshwater Lake Sediment | MDTETIQEIDEALSHAVDTRSKTIDSKKHIVDRFIDDLLDSRLELTKC |
| Ga0211734_1011970515 | 3300020159 | Freshwater | MDVKTETISEIDEALLHALVSRKNSIDSKKHIVDRFIDELLDARIEVAKC |
| Ga0211726_102276262 | 3300020161 | Freshwater | MDTETLQEIDEALAYAVDTRAKTIDSKKHIVDKFIDELLDSRLELTKC |
| Ga0211735_114046543 | 3300020162 | Freshwater | MNTETLQEIDEALAYAVDTRAKTIDSKKHIVDKFIDELLDSRLELTKC |
| Ga0208091_10139593 | 3300020506 | Freshwater | MDNETETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSR |
| Ga0213920_10513462 | 3300021438 | Freshwater | MNSDIETIEEIDEALLHAYLTRQQTIDSKKHIVDKFIDDLLDSRLELTND |
| Ga0222713_103600122 | 3300021962 | Estuarine Water | MDTETIQEIDEALSHAVDTRAKTIDSKNHIVDKFIDDLLDSRLELTRC |
| Ga0181354_10853944 | 3300022190 | Freshwater Lake | ETIQEIDEALSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0214917_1000133052 | 3300022752 | Freshwater | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSQ |
| Ga0244777_102965131 | 3300024343 | Estuarine | DEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTR |
| Ga0244775_113642733 | 3300024346 | Estuarine | IDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTR |
| Ga0244775_114961163 | 3300024346 | Estuarine | IQEIDEALSHAVDTRTKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0209182_102372482 | 3300025843 | Lake Sediment | MNGEAMDATLETVTEIDEALAYALATRKAARDSKKHLVDKFIDDLLDSRSALTKC |
| Ga0209651_10722561 | 3300027581 | Freshwater Lake | ALSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0209356_11867801 | 3300027644 | Freshwater Lake | MDTETIQEIDEALSHAIITRANAIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0208975_10135044 | 3300027659 | Freshwater Lentic | MDTETIEEIDEALSHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0209188_10645444 | 3300027708 | Freshwater Lake | MSDIETLEEIDEALLHAYLTRQQTIDSKKHIVDKFIDDLLDSRLELTR |
| Ga0209492_10000702 | 3300027721 | Freshwater Sediment | MDTETIQEIDEALLHAINTRANTIDSKKHIVDKFIDDLLDSRLELTRC |
| Ga0209190_10165843 | 3300027736 | Freshwater Lake | MIMDADTETIEEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSK |
| Ga0209085_11278322 | 3300027741 | Freshwater Lake | MDKEMTSDIETVEEIDEALLHAYLTRKQTIDSKKHIVDKFIDDLLDSRLELTR |
| Ga0209296_10075629 | 3300027759 | Freshwater Lake | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSE |
| Ga0209296_12809441 | 3300027759 | Freshwater Lake | MAANNETIAEIDEALLHAIFTRQQSIDSKKHLVDKFIDDLLDSRLELSQ |
| Ga0209134_100361954 | 3300027764 | Freshwater Lake | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSK |
| Ga0209134_103050781 | 3300027764 | Freshwater Lake | LLSHHTAHQLGWALLIYGQDMDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0209829_100010243 | 3300027777 | Freshwater Lake | MDSDIETLEEIDEALAHALITRKQSIDSKKHIVDKFIDDLLDSRLELTK |
| Ga0209500_102565071 | 3300027782 | Freshwater Lake | MDIDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSQ |
| Ga0209287_101265092 | 3300027792 | Freshwater Sediment | LGFIHLWDKGMDTETIQEIDEALAHAVDTRAKAIDSKKHIIDKFIDDLLDTRLELTKC |
| Ga0209107_101142544 | 3300027797 | Freshwater And Sediment | MDTETVEEVDEALAHAVDTRAKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0209107_101778014 | 3300027797 | Freshwater And Sediment | ALFIFGQDMDTETLREIDEALAYAVDTRAKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0209990_102875093 | 3300027816 | Freshwater Lake | MDMDTETIEEVDEAIFHAYLTRSQTRDSQKHIIDKLIDDLLDSRLELMQC |
| Ga0209990_103040471 | 3300027816 | Freshwater Lake | AHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0209668_100582573 | 3300027899 | Freshwater Lake Sediment | MDTETIQEIDEALAHAVDTRAKTIDSKKHIVNKFIDDLLDSRLELSKC |
| Ga0209401_10404143 | 3300027971 | Freshwater Lake | MSDIETLEEIDEALLHAYLTRQQTIDSKKHIVDKFIDDLLDSRLELTND |
| Ga0209299_12417103 | 3300027974 | Freshwater Lake | EIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSK |
| Ga0247723_100035855 | 3300028025 | Deep Subsurface Sediment | MDTETIKEIDEALAFAVSTRANTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0247723_10216453 | 3300028025 | Deep Subsurface Sediment | MDMDTETIEEVDEALSHAIITRANTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0247723_10725212 | 3300028025 | Deep Subsurface Sediment | MNTETIKEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTR |
| Ga0304729_10003324 | 3300028392 | Freshwater Lake | MTSDIETVEEIDEALLHAYLTRKQTIDSKKHIVDKFIDDLLDSRLELTR |
| Ga0315907_101752202 | 3300031758 | Freshwater | MDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0315899_115484933 | 3300031784 | Freshwater | DTETIQEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0315908_110280093 | 3300031786 | Freshwater | TETIQEIDEALSHAIITRANAIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0315900_104160421 | 3300031787 | Freshwater | GQDMDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0315900_105269412 | 3300031787 | Freshwater | LLSHHTAHQLGWALLIYGQDMDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDCRLELTKC |
| Ga0315900_108247093 | 3300031787 | Freshwater | SHAIITCANTIDSKKYIVDKFIDDLLDSRLELTKC |
| Ga0315909_101504283 | 3300031857 | Freshwater | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSQ |
| Ga0315909_103518154 | 3300031857 | Freshwater | GWALLIYGQDMDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDCRLELTKC |
| Ga0315909_103893031 | 3300031857 | Freshwater | LSHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0315909_109391593 | 3300031857 | Freshwater | LWMDMDTETIEEVDEAIFHAYLTRSQTRDSQKHIIDKLIDDLLDSRLELMQC |
| Ga0315904_107617261 | 3300031951 | Freshwater | FIYGQDMDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDCRLELTKC |
| Ga0315901_102331754 | 3300031963 | Freshwater | MDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDCRLELTKC |
| Ga0315901_104118901 | 3300031963 | Freshwater | ADWLGFTYLWMDMDTETIEEVDEALSHAIITRANTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0315901_112207111 | 3300031963 | Freshwater | DTETIKEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTR |
| Ga0315906_100562071 | 3300032050 | Freshwater | MNTETIKEIDEALAHAVDTRSKTIDSKKHLVDKFIDDLLDSRLELT |
| Ga0315905_109073083 | 3300032092 | Freshwater | IGMDTETIQEIDEALLHAITTRANAIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0315902_105187222 | 3300032093 | Freshwater | LGFIHLWDKGMDTETIQEIDEALAHAVDTRSKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0315902_112751412 | 3300032093 | Freshwater | MDMDMNTETIKEIDEALAHAVDTRSKTIDSKKHLVDKFIDDLLDSRLELTK |
| Ga0315903_1001581213 | 3300032116 | Freshwater | MDTETIEEVDEAIFHAYLTRSQTRDSQKHIIDKLIDDLLDSRLELMQC |
| Ga0334982_0001433_870_1055 | 3300033981 | Freshwater | MDKDMDTETIKEIDEALAFAVSTRANTIDSKKHIVDKFIDDLLDSRLELAKCSALQSASV |
| Ga0335005_0117302_689_838 | 3300034022 | Freshwater | MDNDTETIEEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSQ |
| Ga0335005_0678152_10_168 | 3300034022 | Freshwater | MDTETIQEIDEALSHAIDTRAKTIDSKKHIVDKFIDDLLDSRLELTKCSVFM |
| Ga0335023_0183873_4_210 | 3300034050 | Freshwater | LLSHHTAHQLGWALLIIGQDMNTETLSEIDEALAYAVDTRAKTIDSKKHIVDKFIDELLDSRLELTKC |
| Ga0335019_0125590_1564_1704 | 3300034066 | Freshwater | ETETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSK |
| Ga0335031_0123733_276_425 | 3300034104 | Freshwater | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVNKFIDDLLDSRLELSK |
| Ga0335036_0084826_1752_1958 | 3300034106 | Freshwater | LLSHHTAQQLGWALLIFGQDMDTETLREIDEALAYAVDTRAKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0335036_0595882_356_508 | 3300034106 | Freshwater | MDMNTETIEEVDEAIFHAYLTRSHTIDSKKHIIDKLIDDLLDSRLELMQC |
| Ga0335056_0375865_533_739 | 3300034120 | Freshwater | LLSHHIAHQLGWALLIYGQDMDTETLKEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDSRLELTKC |
| Ga0335060_0116000_162_311 | 3300034122 | Freshwater | MDTDTETIAEIDEALAHAIASRKTTIDSKKHLVDKFIDDLLDSRLELSR |
| Ga0335060_0616724_3_131 | 3300034122 | Freshwater | KEIDEALAHAVDTRTKTIDSKKHIVDKFIDDLLDSRLELTKC |
| ⦗Top⦘ |