 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300004454 Open in IMG/M |
| Scaffold ID | Ga0064592_1265369 Open in IMG/M |
| Source Dataset Name | Stalagmite microbial communities from Echo Passage, Kartchner Caverns, Arizona, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 520 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Stalagmite → Stalagmite Microbial Communities From Echo Passage, Kartchner Caverns, Arizona, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | 2980 Arizona 90, Benson, AZ 85602, United States | |||||||
| Coordinates | Lat. (o) | 31.837801 | Long. (o) | -110.350292 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009387 | Metagenome / Metatranscriptome | 318 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0064592_12653691 | F009387 | N/A | EEPVIYPAFVLAKFDTLRDEVLSRLGLHRGFPPRNEKRKRKEYAEALLRAFLPQTLSQIRGGKVAGVSMDQAAYFLSWVKTERPEGMEAVGAPKIIRTGFRPGGGGDPDFSYDEYVEFIEHFRDLAHKIPDEVLEAEKVQAAATLT* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |