Scaffold Ga0065203_1463106

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0065203_1463106

Scaffold Ga0065203_1463106

Overview

Basic Information
Taxon OID	3300004449 Open in IMG/M
Scaffold ID	Ga0065203_1463106 Open in IMG/M
Source Dataset Name	Marine microbial communities from Galveston Bay (CSEDA12C HDTS- fraction 12)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2257
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location Name	Galveston Bay, USA
Coordinates	Lat. (^o)	29.5	Long. (^o)	-94.76	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082626	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065203_14631061	F082626	GAGG	MNEKERILIETVMDMINGTLNNMAEDIWHCPAQWLLENWWHSLNAALQIGDHVDSSLNSPEPTDQAESKKRDEHIQPDEPFEV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.