| Basic Information | |
|---|---|
| Taxon OID | 3300004449 Open in IMG/M |
| Scaffold ID | Ga0065203_1462926 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Galveston Bay (CSEDA12C HDTS- fraction 12) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shell Corporation |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2130 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Galveston Bay, USA | |||||||
| Coordinates | Lat. (o) | 29.5 | Long. (o) | -94.76 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000713 | Metagenome / Metatranscriptome | 925 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065203_14629264 | F000713 | N/A | MPLVKKNLTIAAGATSDQVLQGTTYEYVDPGTRIVVAAAESTGTYSGNGVMNFTVNNAEFAKDAALSEKVSGEAFGWNNTGYVMNDMVTTGQVRNRPVITFTNNDASSIDVEVAVFIGG* |
| ⦗Top⦘ |