Basic Information | |
---|---|
Taxon OID | 3300004449 Open in IMG/M |
Scaffold ID | Ga0065203_1459269 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Galveston Bay (CSEDA12C HDTS- fraction 12) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1122 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Galveston Bay, USA | |||||||
Coordinates | Lat. (o) | 29.5 | Long. (o) | -94.76 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000713 | Metagenome / Metatranscriptome | 925 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0065203_14592691 | F000713 | AGGA | MPLVKKNITLAAGATSDQILQGTTYEYVDPGTRLVVAAAESTGTYSGNVVMNFTVNNAEFSRDAAVSEKVSGEAFGWNNTGYVMNDMVTTGQVRNRPVVTFTNND |
⦗Top⦘ |